Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Human (HEK293, Fc)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Human (HEK293, Fc) is the recombinant human-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-human-hek-293-fc.html

Purity

95.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

9308 (Gene_ID) Q01151 (T20-A143) (Accession)

Molecular Weight

50-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rapid antibody fluorescent labeling kit (AP)
EGA0034 1 T (Labeling 100 µg /T)

Rapid antibody fluorescent labeling kit (AP)

Sign In for Pricing
View Details
YY1AP1 siRNA (Human)
CRJ0594-01 15 nmol

YY1AP1 siRNA (Human)

Sign In for Pricing
View Details
YY1AP1 siRNA (Human)
CRJ0594-02 30 nmol

YY1AP1 siRNA (Human)

Sign In for Pricing
View Details
Mouse Myosin-9 (MYH9) ELISA Kit
abx512312 96 Tests

Mouse Myosin-9 (MYH9) ELISA Kit

Sign In for Pricing
View Details
Xpress™ Human STK11 Over-expressing Stable Cell Line
ABC-X3028 1 Vial

Xpress™ Human STK11 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
EL-102
BUP04055-01 1 mg

EL-102

Sign In for Pricing
View Details