Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stromelysin-1/MMP-3, Human

The Stromelysin-1/MMP-3 protein is a multifunctional metalloprotease that degrades a variety of extracellular matrix components and activates molecules such as growth factors, plasminogen, and MMP9. It is released into the ECM and is activated through the plasmin cascade. Stromelysin-1/MMP-3 Protein, Human is the recombinant human-derived Stromelysin-1/MMP-3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Stromelysin-1/MMP-3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-3-protein-human.html

Purity

96.80

Smiles

YPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPET

Molecular Formula

4314 (Gene_ID) P08254 (Y18-T272) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppme1 3'UTR Lenti-reporter-Luc Vector
37392086 1.0 µg

Ppme1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ECHDC1 (NM_001139510) Human Tagged Lenti ORF Clone
RC226894L3 10 µg

ECHDC1 (NM_001139510) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DNALI1 shRNA (m) Lentiviral Particles
sc-143116-V 200 µL

DNALI1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
FN1 Rabbit Polyclonal Antibody (Biotin)
orb2123668 100 µL

FN1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human Endo Beta-N-Acetylglucosaminidase (ENGASE) ELISA Kit
orb1666604-01 48 Tests

Human Endo Beta-N-Acetylglucosaminidase (ENGASE) ELISA Kit

Sign In for Pricing
View Details
Human Endo Beta-N-Acetylglucosaminidase (ENGASE) ELISA Kit
orb1666604-02 96 Tests

Human Endo Beta-N-Acetylglucosaminidase (ENGASE) ELISA Kit

Sign In for Pricing
View Details