Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP1LC3B, Human

MAP1LC3B is a key ubiquitin-like modifier essential for the formation of autophagosome vacuoles, which maintains cellular homeostasis. In mitophagy, it regulates mitochondrial number, suppresses reactive oxygen species and ensures energy efficiency. MAP1LC3B Protein, Human is the recombinant human-derived MAP1LC3B protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MAP1LC3B Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/map1lc3b-protein-human.html

Purity

98.0

Smiles

MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV

Molecular Formula

81631 (Gene_ID) Q9GZQ8 (M1-V125) (Accession)

Molecular Weight

Approximately 16.15 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to N-Acetyl Beta-D-Glucosaminidase (NAGase)
MBS2036686-01 0.1 mL

APC-Linked Polyclonal Antibody to N-Acetyl Beta-D-Glucosaminidase (NAGase)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to N-Acetyl Beta-D-Glucosaminidase (NAGase)
MBS2036686-02 0.2 mL

APC-Linked Polyclonal Antibody to N-Acetyl Beta-D-Glucosaminidase (NAGase)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to N-Acetyl Beta-D-Glucosaminidase (NAGase)
MBS2036686-03 0.5 mL

APC-Linked Polyclonal Antibody to N-Acetyl Beta-D-Glucosaminidase (NAGase)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to N-Acetyl Beta-D-Glucosaminidase (NAGase)
MBS2036686-04 1 mL

APC-Linked Polyclonal Antibody to N-Acetyl Beta-D-Glucosaminidase (NAGase)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to N-Acetyl Beta-D-Glucosaminidase (NAGase)
MBS2036686-05 5 mL

APC-Linked Polyclonal Antibody to N-Acetyl Beta-D-Glucosaminidase (NAGase)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to N-Acetyl Beta-D-Glucosaminidase (NAGase)
MBS2036686-06 5x 5 mL

APC-Linked Polyclonal Antibody to N-Acetyl Beta-D-Glucosaminidase (NAGase)

Sign In for Pricing
View Details