Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glutathione S-transferase Mu 3 (Gstm3)

Product Specifications

Product Name Alternative

(GST class-mu 3) (Glutathione S-transferase GT9.3)

Abbreviation

Recombinant Mouse Gstm3 protein

Gene Name

Gstm3

UniProt

P19639

Expression Region

2-218aa

Organism

Mus musculus (Mouse)

Target Sequence

PMTLGYWNTRGLTHSIRLLLEYTDSSYEEKRYVMGDAPNFDRSQWLSEKFNLGLDFPNLPYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDTLENQVMDTRIQLMIVCCSPDFEKQKPEFLKAIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRFLPRPVFTKIAQWGTD

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.0 kDa

References & Citations

"beta-catenin accumulation in nuclei of hepatocellular carcinoma cells up-regulates glutathione-s-transferase M3 mRNA." Li Y.S., Liu M., Nakata Y., Tang H.B. World J Gastroenterol 17:1772-1778 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-500 1x 500 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), CF640R conjugate, 0.1mg/mL
BNC400200-500 1x 500 µL

MHC II (HLA-DQ) (SPV-L3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1791), CF405S conjugate, 0.1mg/mL
BNC041791-100 1x 100 µL

SOX2 (Transcription Factor) (SOX2/1791), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF405S conjugate, 0.1mg/mL
BNC041864-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vitronectin Receptor / CD51 / CD61 (23C6), CF740 conjugate, 0.1mg/mL
BNC741471-500 1x 500 µL

Vitronectin Receptor / CD51 / CD61 (23C6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details