Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sp-cAMPS-AM
HY-137624 1 Each

Sp-cAMPS-AM

Sign In for Pricing
View Details
Zfp286 Mouse Gene Knockout Kit (CRISPR)
KN519775 1 Kit

Zfp286 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rabbit Polyclonal RPS10 Antibody [mFluor Violet 450 SE]
NBP2-97622MFV450 0.1 mL

Rabbit Polyclonal RPS10 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Anti-Human GZMB Antibody (Fv02), FITC
HY574117-01 1 Each

Anti-Human GZMB Antibody (Fv02), FITC

Sign In for Pricing
View Details
Anti-Human GZMB Antibody (Fv02), FITC
HY574117-02 100 Tests

Anti-Human GZMB Antibody (Fv02), FITC

Sign In for Pricing
View Details
VCF CRISPR Knock Out 293T Cell Line (Human)
49444141 1x 10^6 Cells / 1.0 mL

VCF CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details