CYTL1, Human (HEK293, mFc)
CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.
Product Specifications
Product Name Alternative
CYTL1 Protein, Human (HEK293, mFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html
Purity
96.00
Smiles
TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR
Molecular Formula
54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)
Molecular Weight
Approximately 43 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Hras1, CT (Hras1, Hras, GTPase HRas, H-Ras-1, Transforming protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally processed) (APC)
Hras1, CT (Hras1, Hras, GTPase HRas, H-Ras-1, Transforming protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally processed) (APC)
Estrogen Receptor alpha Recombinant Rabbit monoclonal Antibody
Rabbit anti-Escherichia coli (strain K12/DH10B) UPP Polyclonal Antibody