Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal VSIG8 Antibody (961829) [CoraFluor 1]
FAB94182CL1 0.1 mL

Mouse Monoclonal VSIG8 Antibody (961829) [CoraFluor 1]

Sign In for Pricing
View Details
7(S)-epi Carfilzomib (2S,4S)-Diol
TRC-C183495-25MG 25 mg

7(S)-epi Carfilzomib (2S,4S)-Diol

Sign In for Pricing
View Details
C1orf162 (NM_174896) Human Untagged Clone
SC324619 10 µg

C1orf162 (NM_174896) Human Untagged Clone

Sign In for Pricing
View Details
Rat Early Growth Response 1 (EGR1) CLIA Kit
abx196922 96 Tests

Rat Early Growth Response 1 (EGR1) CLIA Kit

Sign In for Pricing
View Details
JTV1, ID (Aminoacyl tRNA Synthase Complex-interacting Multifunctional Protein 2, Multisynthetase Complex Auxiliary Component p38, Protein JTV-1, PRO0992) (AP) discontinued
J7875-20-AP 200 µL

JTV1, ID (Aminoacyl tRNA Synthase Complex-interacting Multifunctional Protein 2, Multisynthetase Complex Auxiliary Component p38, Protein JTV-1, PRO0992) (AP) discontinued

Sign In for Pricing
View Details
ULK1, ID (Serine/Threonine-protein Kinase ULK1, Unc-51-like Kinase 1, ATG1, KIAA0722) (AP)
MBS6504760-01 0.2 mL

ULK1, ID (Serine/Threonine-protein Kinase ULK1, Unc-51-like Kinase 1, ATG1, KIAA0722) (AP)

Sign In for Pricing
View Details