Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Dafsolimab
DHC27707 100 μg

Research Grade Dafsolimab

Sign In for Pricing
View Details
JBS Tungstate Cluster Kit
JBS-PK-108 10.5 mg

JBS Tungstate Cluster Kit

Sign In for Pricing
View Details
Anti-Carbonic Anhydrase III Antibody, Rabbit Polyclonal
MBS8103024-01 0.1 mL

Anti-Carbonic Anhydrase III Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Carbonic Anhydrase III Antibody, Rabbit Polyclonal
MBS8103024-02 5x 0.1 mL

Anti-Carbonic Anhydrase III Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
SEC13L1 (SEC13) (NM_183352) Human Recombinant Protein
TP322811 20 µg

SEC13L1 (SEC13) (NM_183352) Human Recombinant Protein

Sign In for Pricing
View Details
Interleukin 1 beta (IL-1b, Catabolin, IL-1, IL-1B, IL1-BETA, IL-1 beta, IL1F2) (PerCP) discontinued
I7663-09Q 100 Tests

Interleukin 1 beta (IL-1b, Catabolin, IL-1, IL-1B, IL1-BETA, IL-1 beta, IL1F2) (PerCP) discontinued

Sign In for Pricing
View Details