Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS3AP47 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2009208 1.0 µg DNA

RPS3AP47 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SRP54 Protein Vector (Rat) (pPB-C-His)
PV308082 500 ng

SRP54 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
PLV2-CMV-OVA-Puro Plasmid
PVT68035 2 µg

PLV2-CMV-OVA-Puro Plasmid

Sign In for Pricing
View Details
CAPN2 (Calpain-2 Catalytic Subunit, Calpain-2 Large Subunit, Calcium-activated Neutral Proteinase 2, CANP 2, Calpain M-type, M-calpain, Millimolar-calpain, Calpain Large Polypeptide L2, CANPL2) (MaxLight 490)
124322-ML490 100 µL

CAPN2 (Calpain-2 Catalytic Subunit, Calpain-2 Large Subunit, Calcium-activated Neutral Proteinase 2, CANP 2, Calpain M-type, M-calpain, Millimolar-calpain, Calpain Large Polypeptide L2, CANPL2) (MaxLight 490)

Sign In for Pricing
View Details
Akt3, Recombinant, Human, His-Tag, aa1-479
046007-01 20 µg

Akt3, Recombinant, Human, His-Tag, aa1-479

Sign In for Pricing
View Details
Akt3, Recombinant, Human, His-Tag, aa1-479
046007-02 100 µg

Akt3, Recombinant, Human, His-Tag, aa1-479

Sign In for Pricing
View Details