Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LIAS Pre-designed siRNA Set A
SI008702A 1 Each

Human LIAS Pre-designed siRNA Set A

Sign In for Pricing
View Details
Granulin (GRN) Mouse Monoclonal Antibody [Clone ID: LBI4B9]
AMM17739V 100 µL

Granulin (GRN) Mouse Monoclonal Antibody [Clone ID: LBI4B9]

Sign In for Pricing
View Details
DGKB (NM_145695) Human Over-expression Lysate
LH14294V 100 µg

DGKB (NM_145695) Human Over-expression Lysate

Sign In for Pricing
View Details
Eif3b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4645006 1.0 µg DNA

Eif3b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Influenza A virus Protein PB1-F2 (PB1)
MBS1390511-01 0.02 mg (E-Coli)

Recombinant Influenza A virus Protein PB1-F2 (PB1)

Sign In for Pricing
View Details
Recombinant Influenza A virus Protein PB1-F2 (PB1)
MBS1390511-02 0.1 mg (E-Coli)

Recombinant Influenza A virus Protein PB1-F2 (PB1)

Sign In for Pricing
View Details