Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam175b Mouse shRNA Plasmid (Locus ID 109359)
TL505897 1 Kit

Fam175b Mouse shRNA Plasmid (Locus ID 109359)

Sign In for Pricing
View Details
DCUN1D3 Human Gene Knockout Kit (CRISPR)
KN408082 1 Kit

DCUN1D3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SSTR3 Protein Vector (Mouse) (pPM-C-His)
PV234233 500 ng

SSTR3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
LBX1 (ladybird Homeobox 1, HPX-6, HPX6, LBX1H, Homeobox) (MaxLight 750)
MBS6239145-01 0.1 mL

LBX1 (ladybird Homeobox 1, HPX-6, HPX6, LBX1H, Homeobox) (MaxLight 750)

Sign In for Pricing
View Details
LBX1 (ladybird Homeobox 1, HPX-6, HPX6, LBX1H, Homeobox) (MaxLight 750)
MBS6239145-02 5x 0.1 mL

LBX1 (ladybird Homeobox 1, HPX-6, HPX6, LBX1H, Homeobox) (MaxLight 750)

Sign In for Pricing
View Details
Clec9a (NM_172732) Mouse Tagged ORF Clone
MG223094 10 µg

Clec9a (NM_172732) Mouse Tagged ORF Clone

Sign In for Pricing
View Details