Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSF5 (NM_001080439) Human Tagged Lenti ORF Clone
RC205590L3 10 µg

HSF5 (NM_001080439) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TENT2 (NM_001297744) Human Tagged ORF Clone
RG238475 10 µg

TENT2 (NM_001297744) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ano6 (NM_001108108) Rat Tagged ORF Clone
RR212483 10 µg

Ano6 (NM_001108108) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Btnl9 shRNA (UAS) - Lentiviral mouse Btnl9 shRNA (UAS, RFP) (100)
GTR15200892 1 Vial

Lentiviral mouse Btnl9 shRNA (UAS) - Lentiviral mouse Btnl9 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
GYPE sgRNA CRISPR Lentivector (Human) (Target 2)
K0923403 1.0 µg DNA

GYPE sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Semaphorin 3c (SEMA3C) Rabbit Polyclonal Antibody
TA368876 100 µL

Semaphorin 3c (SEMA3C) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details