Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTOV1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
38126151 3x 1.0 µg DNA

PTOV1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
3-O-Caffeoylquinic acid methyl ester
AB2002 20 mg

3-O-Caffeoylquinic acid methyl ester

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans B0285.3 Polyclonal Antibody
MBS7159671 Inquire

Rabbit anti-Caenorhabditis elegans B0285.3 Polyclonal Antibody

Sign In for Pricing
View Details
LRPAP1 Knockout AGS Polyclonal Cells
ARG2396 1 Million

LRPAP1 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
Mouse Monoclonal GDF-8/Myostatin Antibody (GDF9/4261) [Alexa Fluor 350]
NBP3-08680AF350 100 µL

Mouse Monoclonal GDF-8/Myostatin Antibody (GDF9/4261) [Alexa Fluor 350]

Sign In for Pricing
View Details
RXRβ HDR Plasmid (m)
sc-422768-HDR 20 µg

RXRβ HDR Plasmid (m)

Sign In for Pricing
View Details