Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cynomolgus CD93 Protein, His Tag
32-18459-50 50 µg

Cynomolgus CD93 Protein, His Tag

Sign In for Pricing
View Details
Recombinant Quaternary ammonium compound-resistance protein sugE (sugE)
MBS7030629-01 0.02 mg

Recombinant Quaternary ammonium compound-resistance protein sugE (sugE)

Sign In for Pricing
View Details
Recombinant Quaternary ammonium compound-resistance protein sugE (sugE)
MBS7030629-02 0.1 mg

Recombinant Quaternary ammonium compound-resistance protein sugE (sugE)

Sign In for Pricing
View Details
Recombinant Quaternary ammonium compound-resistance protein sugE (sugE)
MBS7030629-03 5x 0.1 mg

Recombinant Quaternary ammonium compound-resistance protein sugE (sugE)

Sign In for Pricing
View Details
TSHB (Thyrotropin Subunit beta, Thyroid-stimulating Hormone Subunit beta, TSH-B, TSH-beta, Thyrotropin beta Chain, Thyrotropin alfa) (MaxLight 405) discontinued
T5400-22R-ML405 100 µL

TSHB (Thyrotropin Subunit beta, Thyroid-stimulating Hormone Subunit beta, TSH-B, TSH-beta, Thyrotropin beta Chain, Thyrotropin alfa) (MaxLight 405) discontinued

Sign In for Pricing
View Details
NUP98 Recombinant Antibody, Cy5 Conjugated
bsm-61197R-Cy5-01 20 µL

NUP98 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details