Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Menadione Sodium Bisulphite For Lab use 94.0%
147895 25 g

Menadione Sodium Bisulphite For Lab use 94.0%

Sign In for Pricing
View Details
Scutellarin
SM2081-100mg 100 mg

Scutellarin

Sign In for Pricing
View Details
Human Phospholipase A2, Group IIA (PLA2G2A) Protein
abx073633-01 2 µg

Human Phospholipase A2, Group IIA (PLA2G2A) Protein

Sign In for Pricing
View Details
Human Phospholipase A2, Group IIA (PLA2G2A) Protein
abx073633-02 10 µg

Human Phospholipase A2, Group IIA (PLA2G2A) Protein

Sign In for Pricing
View Details
Human Phospholipase A2, Group IIA (PLA2G2A) Protein
abx073633-03 1 mg

Human Phospholipase A2, Group IIA (PLA2G2A) Protein

Sign In for Pricing
View Details
VAMP3 Antibody
E51A06266 100 µL

VAMP3 Antibody

Sign In for Pricing
View Details