Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nprl2 3'UTR Luciferase Stable Cell Line
TU114267 1.0 mL

Nprl2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Chondrogenic Differentiation Medium for Mouse Bone Marrow Mesenchymal Stem Cells
abx705190-01 100 mL

Chondrogenic Differentiation Medium for Mouse Bone Marrow Mesenchymal Stem Cells

Sign In for Pricing
View Details
Chondrogenic Differentiation Medium for Mouse Bone Marrow Mesenchymal Stem Cells
abx705190-02 200 mL

Chondrogenic Differentiation Medium for Mouse Bone Marrow Mesenchymal Stem Cells

Sign In for Pricing
View Details
Compound NP-024446
MBS5792964 Inquire

Compound NP-024446

Sign In for Pricing
View Details
Osmr Mouse Pre-designed siRNA Set A
HY-RS17541 1 Set

Osmr Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
AK4 Protein (N-cleavage, Human)
P522057 100 µg

AK4 Protein (N-cleavage, Human)

Sign In for Pricing
View Details