Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR91 Rabbit Polyclonal Antibody
E53P07142 100 µL

WDR91 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UGT1A10 3'UTR GFP Stable Cell Line
TU077790 1.0 mL

UGT1A10 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DiagNano™ Quantum Dots Cell labeling kit, 565 nm
DNK-L010 1 Kit

DiagNano™ Quantum Dots Cell labeling kit, 565 nm

Sign In for Pricing
View Details
HRP Linked Polyclonal Antibody to Vascular Endothelial Growth Factor D (VEGFD)
MBS2128645-01 0.1 mL

HRP Linked Polyclonal Antibody to Vascular Endothelial Growth Factor D (VEGFD)

Sign In for Pricing
View Details
HRP Linked Polyclonal Antibody to Vascular Endothelial Growth Factor D (VEGFD)
MBS2128645-02 0.2 mL

HRP Linked Polyclonal Antibody to Vascular Endothelial Growth Factor D (VEGFD)

Sign In for Pricing
View Details
HRP Linked Polyclonal Antibody to Vascular Endothelial Growth Factor D (VEGFD)
MBS2128645-03 0.5 mL

HRP Linked Polyclonal Antibody to Vascular Endothelial Growth Factor D (VEGFD)

Sign In for Pricing
View Details