Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Spike Glycoprotein (S Protein Full Length) His-Tag Adenovirus
COV00104 1 mL

SARS-CoV-2 Spike Glycoprotein (S Protein Full Length) His-Tag Adenovirus

Sign In for Pricing
View Details
Mant-GMP, S pack
JBS-NU-237S 150 μL

Mant-GMP, S pack

Sign In for Pricing
View Details
Lentiviral mouse Ucn2 shRNA (UAS) - Lentiviral mouse Ucn2 shRNA (UAS, RFP) (100)
GTR15248820 1 Vial

Lentiviral mouse Ucn2 shRNA (UAS) - Lentiviral mouse Ucn2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Mouse Monoclonal EPHX1 Antibody (OTI3F10) [Alexa Fluor 594]
NBP2-70646AF594 0.1 mL

Mouse Monoclonal EPHX1 Antibody (OTI3F10) [Alexa Fluor 594]

Sign In for Pricing
View Details
Aurora A Mouse Monoclonal Antibody(2B3)
RA10322-01 50 µL

Aurora A Mouse Monoclonal Antibody(2B3)

Sign In for Pricing
View Details
Aurora A Mouse Monoclonal Antibody(2B3)
RA10322-02 100 µL

Aurora A Mouse Monoclonal Antibody(2B3)

Sign In for Pricing
View Details