Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human TBX21 pAb
PA13798-01 50 μL

Rabbit Anti-Human TBX21 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human TBX21 pAb
PA13798-02 100 μL

Rabbit Anti-Human TBX21 pAb

Sign In for Pricing
View Details
Bovine Interleukin 1 IL-1 ELISA Kit
BG-BVN11444 1 Each

Bovine Interleukin 1 IL-1 ELISA Kit

Sign In for Pricing
View Details
Tmem19 (NM_133683) Mouse Untagged Clone
MC203845 10 µg

Tmem19 (NM_133683) Mouse Untagged Clone

Sign In for Pricing
View Details
SLC19A1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2171605 3x 1.0 µg

SLC19A1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RGS4 (Regulator of G-Protein Signaling 4, Regulator of G-Protein Signalling 4, RGS-4, MGC2124, MGC60244, RGP4, SCZD9) (APC)
132537-APC 100 µL

RGS4 (Regulator of G-Protein Signaling 4, Regulator of G-Protein Signalling 4, RGS-4, MGC2124, MGC60244, RGP4, SCZD9) (APC)

Sign In for Pricing
View Details