Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TGFB1/TGF-beta-1 Antibody , PerCP
E55A09021 50 Tests

Human TGFB1/TGF-beta-1 Antibody , PerCP

Sign In for Pricing
View Details
CCDC91 Human siRNA Oligo Duplex (Locus ID 55297)
SR310657 1 Kit

CCDC91 Human siRNA Oligo Duplex (Locus ID 55297)

Sign In for Pricing
View Details
Elab Fluor® 647-conjugated Vinculin Monoclonal Antibody
AN00297M-01 25 µL

Elab Fluor® 647-conjugated Vinculin Monoclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 647-conjugated Vinculin Monoclonal Antibody
AN00297M-02 100 µL

Elab Fluor® 647-conjugated Vinculin Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Snx25 shRNA (UAS) - Lentiviral mouse Snx25 shRNA (UAS) (25)
GTR15166361 1 Vial

Lentiviral mouse Snx25 shRNA (UAS) - Lentiviral mouse Snx25 shRNA (UAS) (25)

Sign In for Pricing
View Details
PR3 (PRTN3) Mouse Monoclonal Antibody [Clone ID: LBI2H7]
AMM17710V 100 µL

PR3 (PRTN3) Mouse Monoclonal Antibody [Clone ID: LBI2H7]

Sign In for Pricing
View Details