Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTL1, Human (HEK293, mFc)

CYTL1 protein is specifically expressed in CD34+ hematopoietic cells, indicating that it exists selectively in this hematopoietic cell subpopulation. This targeted expression pattern suggests a potential role in maintaining or differentiating CD34+ cells, emphasizing the importance of CYTL1 in the complex molecular processes that control blood cell development. CYTL1 Protein, Human (HEK293, mFc) is the recombinant human-derived CYTL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CYTL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cytl1-protein-human-hek293-fc.html

Purity

96.00

Smiles

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Molecular Formula

54360 (Gene_ID) Q9NRR1 (T23-R136) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PY ELISA Kit
EHP0746 96 Tests

Human PY ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Ribonuclease 3/RNASE3 (C-6His)
32-7739-50 50 µg

Recombinant Human Ribonuclease 3/RNASE3 (C-6His)

Sign In for Pricing
View Details
CHO Monoclonal Dectin-1/CLEC7A Antibody (Baylor patent anti-Dectin-1) - Humanized - (Dry Ice)
NBP3-28458-50ug 50 µg

CHO Monoclonal Dectin-1/CLEC7A Antibody (Baylor patent anti-Dectin-1) - Humanized - (Dry Ice)

Sign In for Pricing
View Details
α-Hyodeoxycholic Acid
014680 10 g

α-Hyodeoxycholic Acid

Sign In for Pricing
View Details
CD44 Mouse Monoclonal Antibody [Clone ID: OX-49]
CL110P 250 µg

CD44 Mouse Monoclonal Antibody [Clone ID: OX-49]

Sign In for Pricing
View Details
Rat ACTH (Adrenocorticotropic Hormone) ELISA Kit
MBS8801413-01 48 Well

Rat ACTH (Adrenocorticotropic Hormone) ELISA Kit

Sign In for Pricing
View Details