Thioredoxin/TXN, Human
Thioredoxin/TXN protein participates in multiple redox reactions, utilizing its active center dithiol for reversible oxidation and disulfide bond formation. It catalyzes important dithiol-disulfide exchange and plays a key role in S-nitrosylation of cysteine residues in response to intracellular nitric oxide. Thioredoxin/TXN Protein, Human is the recombinant human-derived Thioredoxin/TXN protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
Thioredoxin/TXN Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/thioredoxin-txn-protein-human.html
Purity
98.0
Smiles
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Molecular Formula
7295 (Gene_ID) P10599 (M1-V105) (Accession)
Molecular Weight
Approximately 12 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
APC/CY7-Linked Polyclonal Antibody to Transforming Growth Factor Beta Receptor II (TGFbR2)
APC/CY7-Linked Polyclonal Antibody to Transforming Growth Factor Beta Receptor II (TGFbR2)
APC/CY7-Linked Polyclonal Antibody to Transforming Growth Factor Beta Receptor II (TGFbR2)
APC/CY7-Linked Polyclonal Antibody to Transforming Growth Factor Beta Receptor II (TGFbR2)