Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein UL131 (UL131)

Product Specifications

Abbreviation

Recombinant Human cytomegalovirus Uncharacterized protein UL131

Gene Name

UL131

UniProt

P16773

Expression Region

1-76aa

Organism

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Target Sequence

MCMMSHNKAFFLSLQHAAVSGVAVCLSVRRGAGSVPAGNRGKKTIITEYRITGTRALARCPTKPVTSMWNSSWTSR

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPAP1 Peptide
DF9874-BP 1 mg

RPAP1 Peptide

Sign In for Pricing
View Details
Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial
MBS9020756-01 0.02 mg (E-Coli)

Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial

Sign In for Pricing
View Details
Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial
MBS9020756-02 0.1 mg (E-Coli)

Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial

Sign In for Pricing
View Details
Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial
MBS9020756-03 0.02 mg (Yeast)

Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial

Sign In for Pricing
View Details
Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial
MBS9020756-04 0.1 mg (Yeast)

Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial

Sign In for Pricing
View Details
Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial
MBS9020756-05 0.02 mg (Baculovirus)

Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial

Sign In for Pricing
View Details