Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FITC-Labeled NKG2D/CD314, Human (HEK293, Fc-Flag)

The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance, binding to multiple stress-inducing ligands on tumor and virus-infected cells. It plays a dual role by stimulating NK cells and enhancing T cell activation in CD8 (+) T cell-mediated adaptive responses. FITC-Labeled NKG2D/CD314 Protein, Human (HEK293, Fc) is the recombinant human-derived FITC-Labeled NKG2D/CD314 protein, expressed by HEK293 , with N-hFc, N-Flag labeled tag.

Product Specifications

Product Name Alternative

FITC-Labeled NKG2D/CD314 Protein, Human (HEK293, Fc-Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fitc-labeled-nkg2d-cd314-protein-human-hek293-fc.html

Purity

95.0

Smiles

FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Molecular Formula

22914 (Gene_ID) P26718 (F78-V216) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year, protect from light

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-100 1x 100 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (RT-97), CF640R conjugate, 0.1mg/mL
BNC400454-100 1x 100 µL

Neurofilament (NF-H) (RT-97), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF405S conjugate, 0.1mg/mL
BNC041731-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (Lamb14), CF740 conjugate, 0.1mg/mL
BNC740860-100 1x 100 µL

Human Lambda Light Chain (Lamb14), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details