Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Human (His)

14-3-3 beta proteins serve as adapter proteins that regulate multiple signaling pathways by recognizing phosphoserine or phosphothreonine motifs and regulating chaperone activity. It acts as a negative regulator during osteogenesis, inhibiting nuclear translocation of SRPK2 and preventing neuronal apoptosis. 14-3-3 beta Protein, Human (His) is the recombinant human-derived 14-3-3 beta protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-human-his.html

Purity

99.00

Smiles

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

7529 (Gene_ID) P31946 (M1-N246) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scg5 (NM_009162) Mouse Tagged ORF Clone
MG202313 10 µg

Scg5 (NM_009162) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rat Pigment Epithelium Derived Factor (PEDF) ELISA Kit
RD-PEDF-Ra-01 96 Tests

Rat Pigment Epithelium Derived Factor (PEDF) ELISA Kit

Sign In for Pricing
View Details
Rat Pigment Epithelium Derived Factor (PEDF) ELISA Kit
RD-PEDF-Ra-02 48 Tests

Rat Pigment Epithelium Derived Factor (PEDF) ELISA Kit

Sign In for Pricing
View Details
OR2T12 (NM_001004692) Human Over-expression Lysate
LC423880 20 µg

OR2T12 (NM_001004692) Human Over-expression Lysate

Sign In for Pricing
View Details
(rac-trans)-Bifenthrin-d5
TRC-B383007-1MG 1 mg

(rac-trans)-Bifenthrin-d5

Sign In for Pricing
View Details
Ku70 (XRCC6) Human Gene Knockout Kit (CRISPR)
KN204048LP 1 Kit

Ku70 (XRCC6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details