Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Human (His)

14-3-3 beta proteins serve as adapter proteins that regulate multiple signaling pathways by recognizing phosphoserine or phosphothreonine motifs and regulating chaperone activity. It acts as a negative regulator during osteogenesis, inhibiting nuclear translocation of SRPK2 and preventing neuronal apoptosis. 14-3-3 beta Protein, Human (His) is the recombinant human-derived 14-3-3 beta protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-human-his.html

Purity

99.00

Smiles

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

7529 (Gene_ID) P31946 (M1-N246) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF740 conjugate, 0.1mg/mL
BNC740520-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RGS10 (NM_001005339) Human Over-expression Lysate
LY423865 100 µg

RGS10 (NM_001005339) Human Over-expression Lysate

Sign In for Pricing
View Details
MTUS1 (NM_001001931) Human Over-expression Lysate
LY424280 100 µg

MTUS1 (NM_001001931) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Myeloid tissue
CS808509 5x 5 µm

Tissue FFPE Sections, Myeloid tissue

Sign In for Pricing
View Details
Integrin β3 (Ab-785) Antibody
8B7119-AAT 50 µg

Integrin β3 (Ab-785) Antibody

Sign In for Pricing
View Details
Polystyrene AM RAM
H25031523.100G 100 g

Polystyrene AM RAM

Sign In for Pricing
View Details