Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALK-1, Human (HEK293, His)

ALK-1, also known as ACVRL1, is a type I receptor for TGF-β superfamily with 2 ligands, BMP9 and BMP10. ALK-1 is predominantly expressed in endothelial cells and plays a critical role in regulating developmental and pathological angiogenesis[1][2]. ALK-1 Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 118 amino acids (M1-Q118) .

Product Specifications

Product Name Alternative

ALK-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alk-1-protein-human-hek293-his.html

Smiles

MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ

Molecular Formula

94 (Gene_ID) P37023 (D22-Q118) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]S P Oh, et al. Activin receptor-like kinase 1 modulates transforming growth factor-beta 1 signaling in the regulation of angiogenesis. Proc Natl Acad Sci U S A. 2000 Mar 14;97 (6) :2626-31.|[2]Dianyuan Zhao, et al. ALK1 signaling is required for the homeostasis of Kupffer cells and prevention of bacterial infection. J Clin Invest. 2022 Feb 1;132 (3) :e150489.|[3]Dianne Mitchell, et al. ALK1-Fc inhibits multiple mediators of angiogenesis and suppresses tumor growth. Mol Cancer Ther. 2010 Feb;9 (2) :379-88.|[4]Kerstin Wöltje, et al. Serum induces transcription of Hey1 and Hey2 genes by Alk1 but not Notch signaling in endothelial cells. PLoS One. 2015 Mar 23;10 (3) :e0120547.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Vmn1r217 shRNA (UAS) - Lentiviral mouse Vmn1r217 shRNA (UAS, iRFP) (25)
GTR15151646 1 Vial

Lentiviral mouse Vmn1r217 shRNA (UAS) - Lentiviral mouse Vmn1r217 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
STAT3 polyclonal antibody
BS91286 50ul

STAT3 polyclonal antibody

Sign In for Pricing
View Details
Recombinant Human MAP3K13 Protein, N-His
HT165012-01 50 µg

Recombinant Human MAP3K13 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MAP3K13 Protein, N-His
HT165012-02 100 µg

Recombinant Human MAP3K13 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MAP3K13 Protein, N-His
HT165012-03 1 mg

Recombinant Human MAP3K13 Protein, N-His

Sign In for Pricing
View Details
UQCC2 Rabbit Polyclonal Antibody
orb587157 100 µL

UQCC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details