Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-19 protein (IL19), partial (Active)

Product Specifications

Product Name Alternative

IL-19, NG.1

Abbreviation

Recombinant Human IL19 protein, partial (Active)

Gene Name

IL19

UniProt

Q9UHD0

Expression Region

25-177aa

Organism

Homo sapiens (Human)

Target Sequence

LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis (By similarity) . {ECO:0000250}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 1.5 ng/ml, corresponding to a specific activity of > 6.7x105 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis (By similarity) .

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of AF192498

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Antibody to Baculoviral IAP Repeat Containing Protein 2 (BIRC2)
MBS2005015-01 0.1 mL

Biotin-Linked Antibody to Baculoviral IAP Repeat Containing Protein 2 (BIRC2)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Baculoviral IAP Repeat Containing Protein 2 (BIRC2)
MBS2005015-02 0.2 mL

Biotin-Linked Antibody to Baculoviral IAP Repeat Containing Protein 2 (BIRC2)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Baculoviral IAP Repeat Containing Protein 2 (BIRC2)
MBS2005015-03 0.5 mL

Biotin-Linked Antibody to Baculoviral IAP Repeat Containing Protein 2 (BIRC2)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Baculoviral IAP Repeat Containing Protein 2 (BIRC2)
MBS2005015-04 1 mL

Biotin-Linked Antibody to Baculoviral IAP Repeat Containing Protein 2 (BIRC2)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Baculoviral IAP Repeat Containing Protein 2 (BIRC2)
MBS2005015-05 5 mL

Biotin-Linked Antibody to Baculoviral IAP Repeat Containing Protein 2 (BIRC2)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Baculoviral IAP Repeat Containing Protein 2 (BIRC2)
MBS2005015-06 5x 5 mL

Biotin-Linked Antibody to Baculoviral IAP Repeat Containing Protein 2 (BIRC2)

Sign In for Pricing
View Details