Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAP1, Human (GST)

As a chaperone with ATPase activity, TRAP1 protein plays a crucial role in protecting mitochondrial function and polarization, especially downstream of PINK1 and mitochondrial complex I. TRAP1 acts as a negative regulator of mitochondrial respiration, affecting the balance between oxidative phosphorylation and aerobic glycolysis. TRAP1 Protein, Human (GST) is the recombinant human-derived TRAP1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

TRAP1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trap1-protein-human-gst.html

Purity

90.00

Smiles

STQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVRE

Molecular Formula

10131 (Gene_ID) Q12931 (S60-E308) (Accession)

Molecular Weight

Approximately 54.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human PLA2G1B Protein, N-His
YHC05601 100 μg

Recombinant Human PLA2G1B Protein, N-His

Ask
View Details
Lentiviral mouse Vmn1r171 shRNA (UAS) - Lentiviral mouse Vmn1r171 shRNA (UAS, iRFP) (25)
GTR15165806 1 Vial

Lentiviral mouse Vmn1r171 shRNA (UAS) - Lentiviral mouse Vmn1r171 shRNA (UAS, iRFP) (25)

Ask
View Details
Lck Interacting Molecule (LIME, 2810038K19Rik, Lck-interacting Membrane Protein, Lck Interacting Transmembrane Adaptor 1, Lck-interacting Transmembrane Adapter 1, LIME1)
MBS624728-01 0.1 mg

Lck Interacting Molecule (LIME, 2810038K19Rik, Lck-interacting Membrane Protein, Lck Interacting Transmembrane Adaptor 1, Lck-interacting Transmembrane Adapter 1, LIME1)

Ask
View Details
Lck Interacting Molecule (LIME, 2810038K19Rik, Lck-interacting Membrane Protein, Lck Interacting Transmembrane Adaptor 1, Lck-interacting Transmembrane Adapter 1, LIME1)
MBS624728-02 5x 0.1 mg

Lck Interacting Molecule (LIME, 2810038K19Rik, Lck-interacting Membrane Protein, Lck Interacting Transmembrane Adaptor 1, Lck-interacting Transmembrane Adapter 1, LIME1)

Ask
View Details
(3'-Ethoxy-biphenyl-4-yl) -acetic acid
sc-335899 500 mg

(3'-Ethoxy-biphenyl-4-yl) -acetic acid

Ask
View Details