Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAP1, Human (GST)

As a chaperone with ATPase activity, TRAP1 protein plays a crucial role in protecting mitochondrial function and polarization, especially downstream of PINK1 and mitochondrial complex I. TRAP1 acts as a negative regulator of mitochondrial respiration, affecting the balance between oxidative phosphorylation and aerobic glycolysis. TRAP1 Protein, Human (GST) is the recombinant human-derived TRAP1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

TRAP1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trap1-protein-human-gst.html

Purity

90.00

Smiles

STQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVRE

Molecular Formula

10131 (Gene_ID) Q12931 (S60-E308) (Accession)

Molecular Weight

Approximately 54.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZCCHC13 AAV Vector (Human) (CMV)
50758101 1 µg

ZCCHC13 AAV Vector (Human) (CMV)

Ask
View Details
DIAPH3 (Protein Diaphanous Homolog 3, Diaphanous-related Formin-3, DRF3, DIAP3) (PE)
MBS6376204-01 0.1 mL

DIAPH3 (Protein Diaphanous Homolog 3, Diaphanous-related Formin-3, DRF3, DIAP3) (PE)

Ask
View Details
DIAPH3 (Protein Diaphanous Homolog 3, Diaphanous-related Formin-3, DRF3, DIAP3) (PE)
MBS6376204-02 5x 0.1 mL

DIAPH3 (Protein Diaphanous Homolog 3, Diaphanous-related Formin-3, DRF3, DIAP3) (PE)

Ask
View Details
Calcium Channel, Voltage Dependent, L-Type, Alpha 1D Subunit (CACNa1D) BioAssayTM ELISA Kit (Human)
023852 96 Tests

Calcium Channel, Voltage Dependent, L-Type, Alpha 1D Subunit (CACNa1D) BioAssayTM ELISA Kit (Human)

Ask
View Details
Herpes Simplex Virus II (HSV II, Herpes Simplex Virus 2, HSV2) (FITC) discontinued
H2033-30B-FITC 100 µL

Herpes Simplex Virus II (HSV II, Herpes Simplex Virus 2, HSV2) (FITC) discontinued

Ask
View Details
Psg27 AAV siRNA Pooled Vector
37919164 1.0 µg

Psg27 AAV siRNA Pooled Vector

Ask
View Details