Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAP1, Human (GST)

As a chaperone with ATPase activity, TRAP1 protein plays a crucial role in protecting mitochondrial function and polarization, especially downstream of PINK1 and mitochondrial complex I. TRAP1 acts as a negative regulator of mitochondrial respiration, affecting the balance between oxidative phosphorylation and aerobic glycolysis. TRAP1 Protein, Human (GST) is the recombinant human-derived TRAP1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

TRAP1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trap1-protein-human-gst.html

Purity

90.00

Smiles

STQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVRE

Molecular Formula

10131 (Gene_ID) Q12931 (S60-E308) (Accession)

Molecular Weight

Approximately 54.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Aluminium Sulphate Octadecahydrate Extra Pure
1011060 50 50 Kg

Aluminium Sulphate Octadecahydrate Extra Pure

Ask
View Details
Goat anti-Rabbit IgG Fc - Affinity Pure, ALP Conjugate, min x/bovine horse or human serum proteins
MBS686275-01 1 mg

Goat anti-Rabbit IgG Fc - Affinity Pure, ALP Conjugate, min x/bovine horse or human serum proteins

Ask
View Details
Goat anti-Rabbit IgG Fc - Affinity Pure, ALP Conjugate, min x/bovine horse or human serum proteins
MBS686275-02 5x 1 mg

Goat anti-Rabbit IgG Fc - Affinity Pure, ALP Conjugate, min x/bovine horse or human serum proteins

Ask
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) mug103 Polyclonal Antibody
MBS7180166 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) mug103 Polyclonal Antibody

Ask
View Details
Guinea-pig SAA (Serum Amyloid A) ValidElisa Kit
EK348098 96 Well

Guinea-pig SAA (Serum Amyloid A) ValidElisa Kit

Ask
View Details
Myotilin Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-6479R-BF680 100 µL

Myotilin Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Ask
View Details