Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Oncomodulin (Ocm)

Product Specifications

Product Name Alternative

Parvalbumin beta

Abbreviation

Recombinant Rat Ocm protein

Gene Name

Ocm

UniProt

P02631

Expression Region

2-109aa

Organism

Rattus norvegicus (Rat)

Target Sequence

SITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.0 kDa

References & Citations

"Solution structure of Ca2+-free rat beta-parvalbumin (oncomodulin) ." Henzl M.T., Tanner J.J. Protein Sci. 16:1914-1926 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UTF1 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-12207R-APC-Cy5.5 100 µL

UTF1 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-Human PIK3CG Monoclonal Antibody (1A128)
MHE60902 100 μg

Anti-Human PIK3CG Monoclonal Antibody (1A128)

Sign In for Pricing
View Details
CD5 (CD5 Antigen, CD5 Molecule, LEU1, Lymphocyte Antigen CD5, Lymphocyte Antigen T1/Leu 1, Lymphocyte Glycoprotein T1/Leu1, p56 62, T cell Surface Glycoprotein CD5, T1) (FITC) discontinued
C2256-12B1 100 µg

CD5 (CD5 Antigen, CD5 Molecule, LEU1, Lymphocyte Antigen CD5, Lymphocyte Antigen T1/Leu 1, Lymphocyte Glycoprotein T1/Leu1, p56 62, T cell Surface Glycoprotein CD5, T1) (FITC) discontinued

Sign In for Pricing
View Details
DCAMKL1 Double Nickase Plasmid (h)
sc-402160-NIC 20 µg

DCAMKL1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
GPR172B Double Nickase Plasmid (h2)
sc-407324-NIC-2 20 µg

GPR172B Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Olr1545 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV636849 1.0 µg DNA

Olr1545 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details