Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 anti-mouse CD126 (IL-6Ra chain)
GT02252 25 µg

PE/Cyanine7 anti-mouse CD126 (IL-6Ra chain)

Sign In for Pricing
View Details
Frozen Tissue Sections, Unknown tissue consistent with ovary
CS519901 5x 5 µm

Frozen Tissue Sections, Unknown tissue consistent with ovary

Sign In for Pricing
View Details
Mouse Monoclonal GMPS Antibody (6B5)
H00008833-M02 0.1 mg

Mouse Monoclonal GMPS Antibody (6B5)

Sign In for Pricing
View Details
Zfp579 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7580208 1.0 µg DNA

Zfp579 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Syntrophus aciditrophicus Protein RecA (recA)
MBS1328318-01 0.02 mg (E-Coli)

Recombinant Syntrophus aciditrophicus Protein RecA (recA)

Sign In for Pricing
View Details
Recombinant Syntrophus aciditrophicus Protein RecA (recA)
MBS1328318-02 0.02 mg (Yeast)

Recombinant Syntrophus aciditrophicus Protein RecA (recA)

Sign In for Pricing
View Details