Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAP18 (NM_005870) Human Recombinant Protein
TP305607M 100 µg

SAP18 (NM_005870) Human Recombinant Protein

Sign In for Pricing
View Details
Vmn1r234 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
49643154 3x 1.0 µg DNA

Vmn1r234 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Titanium Wire 1.0 mm diameter, 99.8%
GX1280-10m 10 m

Titanium Wire 1.0 mm diameter, 99.8%

Sign In for Pricing
View Details
T-lymphocyte Activation Antigen CD80, Recombinant, Human, aa35-242, hFc-Tag
586460-01 20 µg

T-lymphocyte Activation Antigen CD80, Recombinant, Human, aa35-242, hFc-Tag

Sign In for Pricing
View Details
T-lymphocyte Activation Antigen CD80, Recombinant, Human, aa35-242, hFc-Tag
586460-02 100 µg

T-lymphocyte Activation Antigen CD80, Recombinant, Human, aa35-242, hFc-Tag

Sign In for Pricing
View Details
SYNPO Protein Vector (Human) (pPB-C-His)
PV134406 500 ng

SYNPO Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details