Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL4 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV712405 1.0 µg DNA

MRPL4 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Porcine Intestinal Mucosal Mononuclear Cell Isolation Kit
P4860 200 mL/Kit

Porcine Intestinal Mucosal Mononuclear Cell Isolation Kit

Sign In for Pricing
View Details
Anti-PRPF4 Antibody (R1D94)
RHA59304 100 μg

Anti-PRPF4 Antibody (R1D94)

Sign In for Pricing
View Details
LOC100502841 3'UTR GFP Stable Cell Line
TU161633 1.0 mL

LOC100502841 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Chemokine Like Factor Superfamily 6 CKLFSF6 ELISA Kit
BG-RAT10604 1 Each

Rat Chemokine Like Factor Superfamily 6 CKLFSF6 ELISA Kit

Sign In for Pricing
View Details
Human substance P receptor (SP-R) ELISA Kit
QY-E04678 96 Tests

Human substance P receptor (SP-R) ELISA Kit

Sign In for Pricing
View Details