Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EHMT1/GLP (EHMT1) (NM_001145527) AAV Particle
RC227601A1V 250 µL

Human EHMT1/GLP (EHMT1) (NM_001145527) AAV Particle

Sign In for Pricing
View Details
SLC30A3 ORF Vector (Human) (pORF)
44112011 1.0 µg DNA

SLC30A3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal EGFR Antibody (31G7) [PerCP]
NBP2-47740PCP 0.1 mL

Mouse Monoclonal EGFR Antibody (31G7) [PerCP]

Sign In for Pricing
View Details
BLT2 probe 1
MF-0154610-01 5 mg

BLT2 probe 1

Sign In for Pricing
View Details
BLT2 probe 1
MF-0154610-02 50 mg

BLT2 probe 1

Sign In for Pricing
View Details
Mouse Rab10 qPCR Primer Pair
QM19746S 200 Tests

Mouse Rab10 qPCR Primer Pair

Sign In for Pricing
View Details