Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NADPH oxidase 4 (NOX4) (NM_001143837) Human Tagged Lenti ORF Clone
RC227479L3 10 µg

NADPH oxidase 4 (NOX4) (NM_001143837) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human CXCL2 (Chemokine (C-X-C motif) ligand 2) ELISA Kit
EH25158 96 Tests

Human CXCL2 (Chemokine (C-X-C motif) ligand 2) ELISA Kit

Sign In for Pricing
View Details
C4A (beta chain) discontinued
386643-01 20 µL

C4A (beta chain) discontinued

Sign In for Pricing
View Details
C4A (beta chain) discontinued
386643-02 200 µL

C4A (beta chain) discontinued

Sign In for Pricing
View Details
pCMV-SPORT6-Ptges2-m Plasmid
PVT18829 2 µg

pCMV-SPORT6-Ptges2-m Plasmid

Sign In for Pricing
View Details
SRD5A2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-6700R-BF594 100 µL

SRD5A2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details