Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM135 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV679619 1.0 µg DNA

TMEM135 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Lentiviral mouse Krt31 shRNA (UAS) - Lentiviral mouse Krt31 shRNA (UAS) plasmid
GTR15216379 1 Vial

Lentiviral mouse Krt31 shRNA (UAS) - Lentiviral mouse Krt31 shRNA (UAS) plasmid

Sign In for Pricing
View Details
WDR51B Blocking Peptide
33R-3452 100 ug

WDR51B Blocking Peptide

Sign In for Pricing
View Details
SH2D6 Recombinant Protein (Human)
RP096735 100 µg

SH2D6 Recombinant Protein (Human)

Sign In for Pricing
View Details
Lentiviral human NEK8 sgRNA gene knockout kit - Lentiviral human NEK8 sgRNA gene knockout kit (plasmid)
GTR15392261 1 Vial

Lentiviral human NEK8 sgRNA gene knockout kit - Lentiviral human NEK8 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Catsper4 3'UTR Luciferase Stable Cell Line
TU201698 1.0 mL

Catsper4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details