Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhesus CD22 HEK293 Overexpression Lysate
MBS8117929-01 0.3 mg

Rhesus CD22 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Rhesus CD22 HEK293 Overexpression Lysate
MBS8117929-02 5x 0.3 mg

Rhesus CD22 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
LRRC48 (DRC3) (NM_001130092) Human Tagged ORF Clone
RG225766 10 µg

LRRC48 (DRC3) (NM_001130092) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human CD162 AssayLite™ Antibody (PerCP Conjugate)
34021-05171 5x 30 µg

Human CD162 AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
Lentiviral mouse Lmx1a shRNA (UAS) - Lentiviral mouse Lmx1a shRNA (UAS, iRFP) (25)
GTR15266450 1 Vial

Lentiviral mouse Lmx1a shRNA (UAS) - Lentiviral mouse Lmx1a shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
RABIF (RAB interacting Factor, MSS4, RASGFR3, OTTHUMP00000038814, RAB-interacting Factor, Ras-specific guanine-releasing Factor 3, Guanine nucleotide exchange Factor MSS4, Mammalian suppressor of SEC4, RASGRF3) (MaxLight 405) discontinued
207860-ML405 100 µL

RABIF (RAB interacting Factor, MSS4, RASGFR3, OTTHUMP00000038814, RAB-interacting Factor, Ras-specific guanine-releasing Factor 3, Guanine nucleotide exchange Factor MSS4, Mammalian suppressor of SEC4, RASGRF3) (MaxLight 405) discontinued

Sign In for Pricing
View Details