CD302/CLEC13A, Rat (HEK293, His)
The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html
Purity
95.00
Smiles
DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH
Molecular Formula
295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)
Molecular Weight
Approximately 18&22 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
MSR1 (Macrophage Scavenger Receptor Type I, SRA, SR-A, CD204, phSR1, phSR2, SCARA1) (MaxLight 750)
MSR1 (Macrophage Scavenger Receptor Type I, SRA, SR-A, CD204, phSR1, phSR2, SCARA1) (MaxLight 750)
Collagen Type III Alpha 1 (COL3a1) Recombinant, Mouse
Collagen Type III Alpha 1 (COL3a1) Recombinant, Mouse
Collagen Type III Alpha 1 (COL3a1) Recombinant, Mouse
