Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gtf2h2 (NM_022011) Mouse Tagged Lenti ORF Clone
MR206208L4 10 µg

Gtf2h2 (NM_022011) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Vps37b ORF Vector (Mouse) (pORF)
ORF061643 1.0 µg DNA

Vps37b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ETS2 (Protein C-ets-2, ETS2IT1)
339249 100 µL

ETS2 (Protein C-ets-2, ETS2IT1)

Sign In for Pricing
View Details
Recombinant Human FKBP9, His-tagged
FKBP9-12918H 25 µg

Recombinant Human FKBP9, His-tagged

Sign In for Pricing
View Details
Human RERGL knockout cell line
ABC-KH12846 1 Vial

Human RERGL knockout cell line

Sign In for Pricing
View Details
Asb6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6552608 1.0 µg DNA

Asb6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details