Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK1G1 / CSNK1G2 / CSNK1G3 Antibody
abx326528-01 50 µg

CSNK1G1 / CSNK1G2 / CSNK1G3 Antibody

Sign In for Pricing
View Details
CSNK1G1 / CSNK1G2 / CSNK1G3 Antibody
abx326528-02 100 µg

CSNK1G1 / CSNK1G2 / CSNK1G3 Antibody

Sign In for Pricing
View Details
RNU6-80 Protein Vector (Human) (pPM-C-His)
PV119001 500 ng

RNU6-80 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ELFN1 Recombinant Protein (Rat)
RP199475 100 µg

ELFN1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
AdmiRa-hsa-miR-5195-5p Virus
mh2148 250 µL

AdmiRa-hsa-miR-5195-5p Virus

Sign In for Pricing
View Details
Human SDF-1 (Stromal Cell Derived Factor 1) CLIA Kit
E-CL-H0052-01 24 Tests

Human SDF-1 (Stromal Cell Derived Factor 1) CLIA Kit

Sign In for Pricing
View Details