Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anxa10 sgRNA CRISPR Lentivector set (Mouse)
K3975101 3x 1.0 µg

Anxa10 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Human DLG3, N-His
MBS1575087-01 0.1 mg

Recombinant Human DLG3, N-His

Sign In for Pricing
View Details
Recombinant Human DLG3, N-His
MBS1575087-02 1 mg

Recombinant Human DLG3, N-His

Sign In for Pricing
View Details
Recombinant Human DLG3, N-His
MBS1575087-03 5x 1 mg

Recombinant Human DLG3, N-His

Sign In for Pricing
View Details
E3 Ubiquitin-Protein Ligase CHIP (STUB1) Antibody
abx457442-01 50 µg

E3 Ubiquitin-Protein Ligase CHIP (STUB1) Antibody

Sign In for Pricing
View Details
E3 Ubiquitin-Protein Ligase CHIP (STUB1) Antibody
abx457442-02 100 µg

E3 Ubiquitin-Protein Ligase CHIP (STUB1) Antibody

Sign In for Pricing
View Details