Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (MaxLight 490)
MBS6201332-01 0.1 mL

ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (MaxLight 490)

Sign In for Pricing
View Details
ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (MaxLight 490)
MBS6201332-02 5x 0.1 mL

ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (MaxLight 490)

Sign In for Pricing
View Details
ASMC Cell Line
RWT-966 1x 10^6

ASMC Cell Line

Sign In for Pricing
View Details
CABP (CABP1) (NM_001033677) Human Tagged ORF Clone
RG206637 10 µg

CABP (CABP1) (NM_001033677) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human Apolipoprotein C-Iv (Apoc4) Elisa Kit
EKC41363 96 Tests

Human Apolipoprotein C-Iv (Apoc4) Elisa Kit

Sign In for Pricing
View Details
Human c-fos (c-fos) ELISA Kit
YLA0586HU-01 48 Tests

Human c-fos (c-fos) ELISA Kit

Sign In for Pricing
View Details