Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS3AP23 sgRNA CRISPR Lentivector set (Human)
K2006901 3x 1.0 µg

RPS3AP23 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
PIRC86 3'UTR GFP Stable Cell Line
TU068082 1.0 mL

PIRC86 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal Dengue Virus NS5 Antibody (02) [Alexa Fluor 700]
NBP3-30750AF700 0.1 mL

Mouse Monoclonal Dengue Virus NS5 Antibody (02) [Alexa Fluor 700]

Sign In for Pricing
View Details
TIMP4 Protein Vector (Rat) (pPB-C-His)
PV310906 500 ng

TIMP4 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Ataxin-3 (ATXN3) Chicken ELISA Kit
B7070 96 Tests

Ataxin-3 (ATXN3) Chicken ELISA Kit

Sign In for Pricing
View Details
GAP43 Knockout 143B Polyclonal Cells
ARG11789 1 Million

GAP43 Knockout 143B Polyclonal Cells

Sign In for Pricing
View Details