Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-ELK4
YF-PA11549 50 ug

anti-ELK4

Sign In for Pricing
View Details
C20orf7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV708212 1.0 µg DNA

C20orf7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Rat Soluble Cluster of differentiation 30 ligand (sCD30L) ELISA KIT
MBS263115-01 48 Well

Rat Soluble Cluster of differentiation 30 ligand (sCD30L) ELISA KIT

Sign In for Pricing
View Details
Rat Soluble Cluster of differentiation 30 ligand (sCD30L) ELISA KIT
MBS263115-02 96 Well

Rat Soluble Cluster of differentiation 30 ligand (sCD30L) ELISA KIT

Sign In for Pricing
View Details
Rat Soluble Cluster of differentiation 30 ligand (sCD30L) ELISA KIT
MBS263115-03 5x 96 Well

Rat Soluble Cluster of differentiation 30 ligand (sCD30L) ELISA KIT

Sign In for Pricing
View Details
Rat Soluble Cluster of differentiation 30 ligand (sCD30L) ELISA KIT
MBS263115-04 10x 96 Well

Rat Soluble Cluster of differentiation 30 ligand (sCD30L) ELISA KIT

Sign In for Pricing
View Details