Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHP-2, Human Recombinant
P1560-10 10 µg

SHP-2, Human Recombinant

Sign In for Pricing
View Details
FADS2 Human shRNA Lentiviral Particle (Locus ID 9415)
TL313101V 500 µL Each

FADS2 Human shRNA Lentiviral Particle (Locus ID 9415)

Sign In for Pricing
View Details
USP9X (Ubiquitin Specific Peptidase 9, X-Linked, DFFRX, FAF, FAM) (MaxLight 750)
MBS6241302-01 0.1 mL

USP9X (Ubiquitin Specific Peptidase 9, X-Linked, DFFRX, FAF, FAM) (MaxLight 750)

Sign In for Pricing
View Details
USP9X (Ubiquitin Specific Peptidase 9, X-Linked, DFFRX, FAF, FAM) (MaxLight 750)
MBS6241302-02 5x 0.1 mL

USP9X (Ubiquitin Specific Peptidase 9, X-Linked, DFFRX, FAF, FAM) (MaxLight 750)

Sign In for Pricing
View Details
Hamster Zinc Finger Protein Ubi-D4 (DPF2) ELISA Kit
MBS9917258-01 48 Well

Hamster Zinc Finger Protein Ubi-D4 (DPF2) ELISA Kit

Sign In for Pricing
View Details
Hamster Zinc Finger Protein Ubi-D4 (DPF2) ELISA Kit
MBS9917258-02 96 Well

Hamster Zinc Finger Protein Ubi-D4 (DPF2) ELISA Kit

Sign In for Pricing
View Details