Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOSPD2 sgRNA CRISPR Lentivector (Human) (Target 2)
K1318803 1.0 µg DNA

MOSPD2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rho GTPase-Activating Protein 18 (ARHGAP18) Antibody
abx033977-01 80 µL

Rho GTPase-Activating Protein 18 (ARHGAP18) Antibody

Sign In for Pricing
View Details
Rho GTPase-Activating Protein 18 (ARHGAP18) Antibody
abx033977-02 400 µL

Rho GTPase-Activating Protein 18 (ARHGAP18) Antibody

Sign In for Pricing
View Details
Mouse Rrm2 qPCR Primer Pair
QM20478S 200 Tests

Mouse Rrm2 qPCR Primer Pair

Sign In for Pricing
View Details
Human TNFRSF17 knockout cell line
ABC-KH15841 1 Vial

Human TNFRSF17 knockout cell line

Sign In for Pricing
View Details
Rat Taste receptor type 2 member 135 (TAS2R135) ELISA Kit
abx551063 96 Tests

Rat Taste receptor type 2 member 135 (TAS2R135) ELISA Kit

Sign In for Pricing
View Details