Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

H3 (pS10) Antibody
abx025104-01 80 µL

H3 (pS10) Antibody

Sign In for Pricing
View Details
H3 (pS10) Antibody
abx025104-02 400 µL

H3 (pS10) Antibody

Sign In for Pricing
View Details
Flamma® 496 Thiol
CWT1001_5 mg 5 mg

Flamma® 496 Thiol

Sign In for Pricing
View Details
Porcine Chondroitin sulfate,CS ELISA Kit
ELA-E0723p 96 Tests

Porcine Chondroitin sulfate,CS ELISA Kit

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe COP9 signalosome complex subunit 4 (csn4)
MBS1018262-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe COP9 signalosome complex subunit 4 (csn4)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe COP9 signalosome complex subunit 4 (csn4)
MBS1018262-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe COP9 signalosome complex subunit 4 (csn4)

Sign In for Pricing
View Details