Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZIC5 Antibody, Biotin conjugated
A64982-100UG 100 µg

ZIC5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Protein Disulfide Isomerase (PDI) (Mouse) ELISA Kit
E4644-100 100 Assays

Protein Disulfide Isomerase (PDI) (Mouse) ELISA Kit

Sign In for Pricing
View Details
Human low-density lipoprotein-receptor-related protein (LRP-6) Elisa Kit
EK711154 96 Well

Human low-density lipoprotein-receptor-related protein (LRP-6) Elisa Kit

Sign In for Pricing
View Details
AMPK b1 Monoclonal Antibody, Cy5 Conjugated
bsm-33427M-Cy5 100 µL

AMPK b1 Monoclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Xpnpep1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7109906 1.0 µg DNA

Xpnpep1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
FineTest®700 Anti-Human CD66b Antibody (G10F5)
F700-30156-01 20 Tests

FineTest®700 Anti-Human CD66b Antibody (G10F5)

Sign In for Pricing
View Details