Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD99 Antibody (SPM596)
NBP2-44696-0.02mg 0.02 mg

Mouse Monoclonal CD99 Antibody (SPM596)

Sign In for Pricing
View Details
Ionomycin (free acid)
1565-1 1 mg

Ionomycin (free acid)

Sign In for Pricing
View Details
Bovine Outer dense fiber protein 3, ODF3 ELISA KIT
ELI-22667b 96 Tests

Bovine Outer dense fiber protein 3, ODF3 ELISA KIT

Sign In for Pricing
View Details
Anti-GLUT5 Rabbit pAb
GB114645-50 50 μL

Anti-GLUT5 Rabbit pAb

Sign In for Pricing
View Details
CCDC66 (NM_001141947) Human Over-expression Lysate
LC427984 20 µg

CCDC66 (NM_001141947) Human Over-expression Lysate

Sign In for Pricing
View Details
DLG3 antibody
FNab02410 100 µg

DLG3 antibody

Sign In for Pricing
View Details