Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grk2 Rat shRNA Lentiviral Particle (Locus ID 25238)
TL709396V 500 µL Each

Grk2 Rat shRNA Lentiviral Particle (Locus ID 25238)

Sign In for Pricing
View Details
Human TDRD1 Pre-designed siRNA Set B
SI016420B 1 Each

Human TDRD1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
FGR Antibody
ABD6803 100 µg

FGR Antibody

Sign In for Pricing
View Details
GCSF Receptor (CSF3R) (NM_156038) Human Tagged ORF Clone
RC219104 10 µg

GCSF Receptor (CSF3R) (NM_156038) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lmf2 Double Nickase Plasmid (m)
sc-430625-NIC 20 µg

Lmf2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Canine Anti-PL12-antibody ELISA Kit
MBS754223-01 48 Well

Canine Anti-PL12-antibody ELISA Kit

Sign In for Pricing
View Details