Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIBU 1361 Dihydrochloride
TRC-B377008-1MG 1 mg

BIBU 1361 Dihydrochloride

Sign In for Pricing
View Details
PE-Cy7 Anti-Mouse CD45R/B220 Antibody (RA3.3A 1/6.1)
PC7-30299-01 50 Tests

PE-Cy7 Anti-Mouse CD45R/B220 Antibody (RA3.3A 1/6.1)

Sign In for Pricing
View Details
PE-Cy7 Anti-Mouse CD45R/B220 Antibody (RA3.3A 1/6.1)
PC7-30299-02 100 Tests

PE-Cy7 Anti-Mouse CD45R/B220 Antibody (RA3.3A 1/6.1)

Sign In for Pricing
View Details
RIMS3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
39597154 3x 1.0 µg DNA

RIMS3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
21q22.2/10p15.3 anomaly probe reagent
FP-334 K Fast probe 100 μL (10-20T), DAPI Staining solution (20T)

21q22.2/10p15.3 anomaly probe reagent

Sign In for Pricing
View Details
PLIN1 Antibody / Perilipin 1
R32951 100 µg

PLIN1 Antibody / Perilipin 1

Sign In for Pricing
View Details