Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-3911 miRNA Antagomir
MNH02117 2x 5.0 nmol

hsa-miR-3911 miRNA Antagomir

Sign In for Pricing
View Details
Tmem189 sgRNA CRISPR Lentivector set (Mouse)
K4827001 3x 1.0 µg

Tmem189 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
HNF1B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV678430 1.0 µg DNA

HNF1B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human Transmembrane Protein 27
MBS146373-01 0.002 mg

Recombinant Human Transmembrane Protein 27

Sign In for Pricing
View Details
Recombinant Human Transmembrane Protein 27
MBS146373-02 0.01 mg

Recombinant Human Transmembrane Protein 27

Sign In for Pricing
View Details
Recombinant Human Transmembrane Protein 27
MBS146373-03 1 mg

Recombinant Human Transmembrane Protein 27

Sign In for Pricing
View Details