Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium voltage-gated channel subfamily H member 2 (KCNH2) Rat ELISA Kit
G0283 96 Tests

Potassium voltage-gated channel subfamily H member 2 (KCNH2) Rat ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human MAP1LC3A pAb
PA5450-01 50 μL

Rabbit Anti-Human MAP1LC3A pAb

Sign In for Pricing
View Details
Rabbit Anti-Human MAP1LC3A pAb
PA5450-02 100 μL

Rabbit Anti-Human MAP1LC3A pAb

Sign In for Pricing
View Details
CST11 Human siRNA Oligo Duplex (Locus ID 140880)
SR315408 1 Kit

CST11 Human siRNA Oligo Duplex (Locus ID 140880)

Sign In for Pricing
View Details
14-3-3 zeta (YWHAZ) Rabbit Polyclonal Antibody
TA325983 100 µL

14-3-3 zeta (YWHAZ) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC25A23 Double Nickase Plasmid (m2)
sc-426300-NIC-2 20 µg

SLC25A23 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details