Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL17A Over-expression Lysate Product
GWB-E6611D 0.1 mg

IL17A Over-expression Lysate Product

Sign In for Pricing
View Details
PerCP/Cyanine5.5 anti-mouse H-2Kd
GT02405 25 µg

PerCP/Cyanine5.5 anti-mouse H-2Kd

Sign In for Pricing
View Details
alpha Glucosidase II antibody
70R-12659 100 ul

alpha Glucosidase II antibody

Sign In for Pricing
View Details
mmu-miR-702-3p Primers
MPM01868 150 µL / 10 µM

mmu-miR-702-3p Primers

Sign In for Pricing
View Details
ASPH (Aspartyl/Asparaginyl beta-hydroxylase, Aspartate beta-hydroxylase, ASP beta-hydroxylase, Peptide-aspartate beta-dioxygenase) (APC)
123638-APC 100 µL

ASPH (Aspartyl/Asparaginyl beta-hydroxylase, Aspartate beta-hydroxylase, ASP beta-hydroxylase, Peptide-aspartate beta-dioxygenase) (APC)

Sign In for Pricing
View Details
TH Protein Lysate (Rat) with C-HA Tag
46622036 100 µg

TH Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details