Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD302/CLEC13A, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD302/CLEC13A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd302-clec13a-protein-rat-hek293-his.html

Purity

95.00

Smiles

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Formula

295629 (Gene_ID) Q5FVR3 (D21-H165) (Accession)

Molecular Weight

Approximately 18&22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-100 1x 100 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-500 1x 500 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-500 1x 500 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details