Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEDF/Serpin F1, Human

PEDF/Serpin F1 Protein, Human is a secreted glycoprotein and a non-inhibitory member of the serine protease inhibitor (serpin) family.

Product Specifications

Product Name Alternative

PEDF/Serpin F1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pedf-protein-human.html

Purity

97.00

Smiles

QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

Molecular Formula

5176 (Gene_ID) P36955 (Q20-P418) (Accession)

Molecular Weight

40-49 kDa

References & Citations

[1]Steele FR, et al. Pigment epithelium-derived factor: neurotrophic activity and identification as a member of the serine protease inhibitor gene family. Proc Natl Acad Sci U S A. 1993 Feb 15;90 (4) :1526-30.|[2]Belkacemi L, et al. Anti-tumor effects of pigment epithelium-derived factor (PEDF) : implication for cancer therapy. A mini-review. J Exp Clin Cancer Res. 2016 Jan 8;35:4.|[3]Yamagishi S, et al. Pigment epithelium-derived factor (PEDF) : its potential therapeutic implication in diabetic vascular complications. Curr Drug Targets. 2008 Nov;9 (11) :1025-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf81 sgRNA CRISPR Lentivector (Human) (Target 3)
K0227404 1.0 µg DNA

C2orf81 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SMAD6 (SMAD Family Member 6, HsT17432, MADH6, MADH7)
251818 50 µL

SMAD6 (SMAD Family Member 6, HsT17432, MADH6, MADH7)

Sign In for Pricing
View Details
ZFX (NM_003410) Human Untagged Clone
SC314740 10 µg

ZFX (NM_003410) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Agrobacterium tumefaciens Flagellar L-ring protein (flgH)
MBS1470780-01 0.02 mg (E-Coli)

Recombinant Agrobacterium tumefaciens Flagellar L-ring protein (flgH)

Sign In for Pricing
View Details
Recombinant Agrobacterium tumefaciens Flagellar L-ring protein (flgH)
MBS1470780-02 0.1 mg (E-Coli)

Recombinant Agrobacterium tumefaciens Flagellar L-ring protein (flgH)

Sign In for Pricing
View Details
Recombinant Agrobacterium tumefaciens Flagellar L-ring protein (flgH)
MBS1470780-03 0.02 mg (Yeast)

Recombinant Agrobacterium tumefaciens Flagellar L-ring protein (flgH)

Sign In for Pricing
View Details