Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWSG1, Mouse (HEK293, His)

The TWSG1 protein may contribute to the formation of the dorsal-ventral axis by counteracting BMP signaling and forming a ternary complex with CHRD and BMP to prevent BMP from binding to the receptor. Notably, TWSG1 exhibits anti-BMP and pro-BMP activities. TWSG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TWSG1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TWSG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/twsg1-protein-mouse-hek293-his.html

Purity

97.60

Smiles

CNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF

Molecular Formula

65960 (Gene_ID) Q9EP52 (C25-F222) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BHMT (Betaine Homocysteine Methyltransferase, Betaine—homocysteine S-methyltransferase)
362280 200 µL

BHMT (Betaine Homocysteine Methyltransferase, Betaine—homocysteine S-methyltransferase)

Ask
View Details
Recombinant Rat Muscarinic acetylcholine receptor M1 Protein, His, Yeast-200ug
QP5831-ye-200ug 200ug

Recombinant Rat Muscarinic acetylcholine receptor M1 Protein, His, Yeast-200ug

Ask
View Details
Human Tumour necrosis factor related weak inducer of apoptosis,TWEAK ELISA KIT
JOT-EK1820Hu 96 wells

Human Tumour necrosis factor related weak inducer of apoptosis,TWEAK ELISA KIT

Ask
View Details
Lentiviral human SGPL1 shRNA (UAS) - Lentiviral human SGPL1 shRNA (UAS, GFP) plasmid
GTR15334921 1 Vial

Lentiviral human SGPL1 shRNA (UAS) - Lentiviral human SGPL1 shRNA (UAS, GFP) plasmid

Ask
View Details
Recombinant Human KHNYN Protein - (Dry Ice)
H00023351-P01-2ug 2 µg

Recombinant Human KHNYN Protein - (Dry Ice)

Ask
View Details