Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWSG1, Mouse (HEK293, His)

The TWSG1 protein may contribute to the formation of the dorsal-ventral axis by counteracting BMP signaling and forming a ternary complex with CHRD and BMP to prevent BMP from binding to the receptor. Notably, TWSG1 exhibits anti-BMP and pro-BMP activities. TWSG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TWSG1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TWSG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/twsg1-protein-mouse-hek293-his.html

Purity

97.60

Smiles

CNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF

Molecular Formula

65960 (Gene_ID) Q9EP52 (C25-F222) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Annexin A1 (Annexin A1, Annexin I, Annexin I (Lipocortin I), Annexin-1, ANX1, ANXA1, Calpactin II, Calpactin-2, Chromobindin-9, Lipocortin I, LPC1, p35, Phospholipase A2 Inhibitory Protein) (FITC) discontinued
253925 60ul

Annexin A1 (Annexin A1, Annexin I, Annexin I (Lipocortin I), Annexin-1, ANX1, ANXA1, Calpactin II, Calpactin-2, Chromobindin-9, Lipocortin I, LPC1, p35, Phospholipase A2 Inhibitory Protein) (FITC) discontinued

Ask
View Details
Zkscan17 (NM_001130529) Mouse Tagged ORF Clone Lentiviral Particle
MR223694L3V 200 µL

Zkscan17 (NM_001130529) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
SLFNL1 antibody
10R-5824 100 ul

SLFNL1 antibody

Ask
View Details
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1225 (AF_1225), partial
MBS7069588 Inquire

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1225 (AF_1225), partial

Ask
View Details
Human RUNX3 Knockout A549 cell line
GTR15405480 1 Vial

Human RUNX3 Knockout A549 cell line

Ask
View Details
Canine Polycomb Group Ring Finger Protein 4 ELISA Kit
MBS068242-01 48 Well

Canine Polycomb Group Ring Finger Protein 4 ELISA Kit

Ask
View Details