Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWSG1, Mouse (HEK293, His)

The TWSG1 protein may contribute to the formation of the dorsal-ventral axis by counteracting BMP signaling and forming a ternary complex with CHRD and BMP to prevent BMP from binding to the receptor. Notably, TWSG1 exhibits anti-BMP and pro-BMP activities. TWSG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TWSG1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TWSG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/twsg1-protein-mouse-hek293-his.html

Purity

97.60

Smiles

CNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF

Molecular Formula

65960 (Gene_ID) Q9EP52 (C25-F222) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Ccnd1 activation kit by CRISPRa
GA200580 1 Kit

Mouse Ccnd1 activation kit by CRISPRa

Ask
View Details
CD40/TNFRSF5, His, Mouse
Z04319-100 100 µg

CD40/TNFRSF5, His, Mouse

Ask
View Details
Tmem9b (NM_001106289) Rat Untagged Clone
RN207322 10 µg

Tmem9b (NM_001106289) Rat Untagged Clone

Ask
View Details
KRT1 (Keratin, Type II Cytoskeletal 1, 67kD Cytokeratin, Cytokeratin-1, CK-1, Hair alpha Protein, Keratin-1, K1, Type-II Keratin Kb1, KRTA) (AP)
MBS6132037-01 0.1 mL

KRT1 (Keratin, Type II Cytoskeletal 1, 67kD Cytokeratin, Cytokeratin-1, CK-1, Hair alpha Protein, Keratin-1, K1, Type-II Keratin Kb1, KRTA) (AP)

Ask
View Details
KRT1 (Keratin, Type II Cytoskeletal 1, 67kD Cytokeratin, Cytokeratin-1, CK-1, Hair alpha Protein, Keratin-1, K1, Type-II Keratin Kb1, KRTA) (AP)
MBS6132037-02 5x 0.1 mL

KRT1 (Keratin, Type II Cytoskeletal 1, 67kD Cytokeratin, Cytokeratin-1, CK-1, Hair alpha Protein, Keratin-1, K1, Type-II Keratin Kb1, KRTA) (AP)

Ask
View Details
Histone H3, phosphorylated (Ser10), acetylated (Ac-K14) (Biotin) discontinued
H5110-12H-Biotin 100 µL

Histone H3, phosphorylated (Ser10), acetylated (Ac-K14) (Biotin) discontinued

Ask
View Details