Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWSG1, Mouse (HEK293, His)

The TWSG1 protein may contribute to the formation of the dorsal-ventral axis by counteracting BMP signaling and forming a ternary complex with CHRD and BMP to prevent BMP from binding to the receptor. Notably, TWSG1 exhibits anti-BMP and pro-BMP activities. TWSG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TWSG1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TWSG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/twsg1-protein-mouse-hek293-his.html

Purity

97.60

Smiles

CNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF

Molecular Formula

65960 (Gene_ID) Q9EP52 (C25-F222) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NT-3 (Neurotrophin 3, HDNF, NGF-2, Nerve growth factor-2) (MaxLight 550) discontinued
N6000-07-ML550 100 µL

NT-3 (Neurotrophin 3, HDNF, NGF-2, Nerve growth factor-2) (MaxLight 550) discontinued

Ask
View Details
SNF2h (SMARCA5, Sucrose Nonfermenting Protein 2 Homolog, ATP-dependent Chromatin Remodeling Protein, hISWI, hSNF2H, ISWI, Sucrose Nonfermenting-like 5, SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin A5, SWI/SNF Related Matrix Associated Actin Dependent Regulator of Chromatin Subfamily A Member 5, SMCA5, WCRF135) (HRP) discontinued
S1014-82D-HRP 100 µL

SNF2h (SMARCA5, Sucrose Nonfermenting Protein 2 Homolog, ATP-dependent Chromatin Remodeling Protein, hISWI, hSNF2H, ISWI, Sucrose Nonfermenting-like 5, SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin A5, SWI/SNF Related Matrix Associated Actin Dependent Regulator of Chromatin Subfamily A Member 5, SMCA5, WCRF135) (HRP) discontinued

Ask
View Details
Hamster Mitotic Checkpoint Serine/Threonine-Protein Kinase BUB1 Beta (BUB1B) ELISA Kit
MBS9353314-01 48 Well

Hamster Mitotic Checkpoint Serine/Threonine-Protein Kinase BUB1 Beta (BUB1B) ELISA Kit

Ask
View Details
Hamster Mitotic Checkpoint Serine/Threonine-Protein Kinase BUB1 Beta (BUB1B) ELISA Kit
MBS9353314-02 96 Well

Hamster Mitotic Checkpoint Serine/Threonine-Protein Kinase BUB1 Beta (BUB1B) ELISA Kit

Ask
View Details
Hamster Mitotic Checkpoint Serine/Threonine-Protein Kinase BUB1 Beta (BUB1B) ELISA Kit
MBS9353314-03 5x 96 Well

Hamster Mitotic Checkpoint Serine/Threonine-Protein Kinase BUB1 Beta (BUB1B) ELISA Kit

Ask
View Details
Hamster Mitotic Checkpoint Serine/Threonine-Protein Kinase BUB1 Beta (BUB1B) ELISA Kit
MBS9353314-04 10x 96 Well

Hamster Mitotic Checkpoint Serine/Threonine-Protein Kinase BUB1 Beta (BUB1B) ELISA Kit

Ask
View Details