Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWSG1, Mouse (HEK293, His)

The TWSG1 protein may contribute to the formation of the dorsal-ventral axis by counteracting BMP signaling and forming a ternary complex with CHRD and BMP to prevent BMP from binding to the receptor. Notably, TWSG1 exhibits anti-BMP and pro-BMP activities. TWSG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TWSG1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TWSG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/twsg1-protein-mouse-hek293-his.html

Purity

97.60

Smiles

CNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF

Molecular Formula

65960 (Gene_ID) Q9EP52 (C25-F222) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cephapirin Sodium
TRC-C261510-25MG 25 mg

Cephapirin Sodium

Ask
View Details
Estriol-3, Antibody
GWB-3CA159 1 mg

Estriol-3, Antibody

Ask
View Details
MYL9 (Myosin Regulatory Light Polypeptide 9, 20kD Myosin Light Chain, LC20, MLC-2C, Myosin RLC, Myosin Regulatory Light Chain 2, Smooth Muscle Isoform, Myosin Regulatory Light Chain 9, Myosin Regulatory Light Chain MRLC1, MLC2, MRLC1, MYRL2, MGC3505) (PE)
130062-PE 100 µL

MYL9 (Myosin Regulatory Light Polypeptide 9, 20kD Myosin Light Chain, LC20, MLC-2C, Myosin RLC, Myosin Regulatory Light Chain 2, Smooth Muscle Isoform, Myosin Regulatory Light Chain 9, Myosin Regulatory Light Chain MRLC1, MLC2, MRLC1, MYRL2, MGC3505) (PE)

Ask
View Details
Mouse Homovanillic Acid (HVA) ELISA Kit
EIA05826m 1 Kit

Mouse Homovanillic Acid (HVA) ELISA Kit

Ask
View Details
Integrin alpha 5
377460 100 µg

Integrin alpha 5

Ask
View Details