Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWSG1, Mouse (HEK293, His)

The TWSG1 protein may contribute to the formation of the dorsal-ventral axis by counteracting BMP signaling and forming a ternary complex with CHRD and BMP to prevent BMP from binding to the receptor. Notably, TWSG1 exhibits anti-BMP and pro-BMP activities. TWSG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TWSG1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TWSG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/twsg1-protein-mouse-hek293-his.html

Purity

97.60

Smiles

CNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF

Molecular Formula

65960 (Gene_ID) Q9EP52 (C25-F222) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-500 1x 500 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL
BNC940437-500 1x 500 µL

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-500 1x 500 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF488A conjugate, 0.1mg/mL
BNC880305-100 1x 100 µL

CD95 (B-R18), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details