Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, His)

Irisin Protein is an important cytokine secreted by muscles during exercise, which has multiple functions such as regulating metabolism and improving health. Irisin Protein, Human/Mouse/Rat (HEK293, His) is a recombinant Irisin Protein expressed by HEK293 and carrying a C-6*His tag[1][2][3].

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, His), Mouse; Rat; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Polyzos SA, et al. Irisin in metabolic diseases. Endocrine. 2018 Feb;59 (2) :260-274.|[3]Liu S, et al. Role of irisin in physiology and pathology. Front Endocrinol (Lausanne) . 2022 Sep 26;13:962968.|[4]Li T, et al. Irisin suppresses pancreatic β cell pyroptosis in T2DM by inhibiting the NLRP3-GSDMD pathway and activating the Nrf2-TrX/TXNIP signaling axis. Diabetol Metab Syndr. 2023 Nov 22;15 (1) :239.|[5]Wang C, et al. Irisin inhibits microglial senescence via TFAM-mediated mitochondrial metabolism in a mouse model of tauopathy. Immun Ageing. 2024 May 14;21 (1) :30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NAA10/ARD1 Protein, Human, Recombinant (His & GST)
MF-0134521-01 5 µg

NAA10/ARD1 Protein, Human, Recombinant (His & GST)

Ask
View Details
NAA10/ARD1 Protein, Human, Recombinant (His & GST)
MF-0134521-02 10 µg

NAA10/ARD1 Protein, Human, Recombinant (His & GST)

Ask
View Details
NAA10/ARD1 Protein, Human, Recombinant (His & GST)
MF-0134521-03 20 µg

NAA10/ARD1 Protein, Human, Recombinant (His & GST)

Ask
View Details
NAA10/ARD1 Protein, Human, Recombinant (His & GST)
MF-0134521-04 50 µg

NAA10/ARD1 Protein, Human, Recombinant (His & GST)

Ask
View Details
NAA10/ARD1 Protein, Human, Recombinant (His & GST)
MF-0134521-05 100 µg

NAA10/ARD1 Protein, Human, Recombinant (His & GST)

Ask
View Details
Thap3 ORF Vector (Mouse) (pORF)
46631015 1.0 µg DNA

Thap3 ORF Vector (Mouse) (pORF)

Ask
View Details