Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4E, Rhesus Macaque (HEK293, hFc)

CLEC4E Protein is a calcium-dependent lectin displaying mannose-binding specificity, and induces the formation of Birbeck granules (BGs) . CLEC4E Protein is a potent regulator of membrane superimposition and zippering, and binds to sulfated as well as mannosylated glycans, keratan sulfate (KS) and beta-glucans. CLEC4E Protein, Rhesus Macaque (HEK293, hFc) is the recombinant rhesus macaque-derived CLEC4E, expressed by HEK293, with N-hFc labeled tag.

Product Specifications

Product Name Alternative

CLEC4E Protein, Rhesus Macaque (HEK293, hFc), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec4e-protein-rhesus-macaque-hek293-n-hfc.html

Purity

97.00

Smiles

RCVVTYHIFQSCDEKKFQLHENFTELSCYNDGSGSVKNCCPSNWEYFQSSCYFFSTDTIPWTSSLKNCSAMGAHLVIINSQEEQEFLAYKKPKMKEFFIGLSDKVVEGQWHWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDATCFFSYFRICERLGINILNKGKSI

Molecular Formula

722250 (Gene_ID) XP_001118423.1 (R41-I219) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF865, CT (ZNF865, Zinc finger protein 865) (MaxLight 490)
MBS6367950-01 0.1 mL

ZNF865, CT (ZNF865, Zinc finger protein 865) (MaxLight 490)

Ask
View Details
ZNF865, CT (ZNF865, Zinc finger protein 865) (MaxLight 490)
MBS6367950-02 5x 0.1 mL

ZNF865, CT (ZNF865, Zinc finger protein 865) (MaxLight 490)

Ask
View Details
Rabbit High Sensitivity Cardiac Troponin I ELISA Kit
MBS7256927-01 48 Well

Rabbit High Sensitivity Cardiac Troponin I ELISA Kit

Ask
View Details
Rabbit High Sensitivity Cardiac Troponin I ELISA Kit
MBS7256927-02 96 Well

Rabbit High Sensitivity Cardiac Troponin I ELISA Kit

Ask
View Details
Rabbit High Sensitivity Cardiac Troponin I ELISA Kit
MBS7256927-03 5x 96 Well

Rabbit High Sensitivity Cardiac Troponin I ELISA Kit

Ask
View Details
Rabbit High Sensitivity Cardiac Troponin I ELISA Kit
MBS7256927-04 10x 96 Well

Rabbit High Sensitivity Cardiac Troponin I ELISA Kit

Ask
View Details