Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gamma-synuclein (Sncg)

Product Specifications

Product Name Alternative

Persyn

Abbreviation

Recombinant Mouse Sncg protein

Gene Name

Sncg

UniProt

Q9Z0F7

Expression Region

1-123aa

Organism

Mus musculus (Mouse)

Target Sequence

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEENEEAKSGED

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAMP3 (NM_004781) Human Over-expression Lysate
LY401501 100 µg

VAMP3 (NM_004781) Human Over-expression Lysate

Sign In for Pricing
View Details
Texas Red Conjugated Goat Affinity Purified Antibody to Rabbit IgG
TAF-012-2 2 mL

Texas Red Conjugated Goat Affinity Purified Antibody to Rabbit IgG

Sign In for Pricing
View Details
CD68 Mouse Monoclonal Antibody [Clone ID: KP1 + C68/684]
AM50247PU-S 100 µg

CD68 Mouse Monoclonal Antibody [Clone ID: KP1 + C68/684]

Sign In for Pricing
View Details
AdSS 2 (ADSS) (NM_001126) Human Over-expression Lysate
LY400453 100 µg

AdSS 2 (ADSS) (NM_001126) Human Over-expression Lysate

Sign In for Pricing
View Details
SMAD3 Rabbit Polyclonal Antibody
TA392658 100 µL

SMAD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NSUN3 (N-term) Rabbit Polyclonal Antibody
AP52943PU-N 400 µL

NSUN3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details