Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gamma-synuclein (Sncg)

Product Specifications

Product Name Alternative

Persyn

Abbreviation

Recombinant Mouse Sncg protein

Gene Name

Sncg

UniProt

Q9Z0F7

Expression Region

1-123aa

Organism

Mus musculus (Mouse)

Target Sequence

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEENEEAKSGED

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung: right upper lobe
CR562485 5 µg

Tissue Total RNA, Lung: right upper lobe

Sign In for Pricing
View Details
2610044O15Rik8 (NM_153780) Mouse Tagged ORF Clone
MG200213 10 µg

2610044O15Rik8 (NM_153780) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Spopl Mouse Gene Knockout Kit (CRISPR)
KN516642 1 Kit

Spopl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EWSR1 Mouse Monoclonal Antibody [Clone ID: OTI3F6]
CF813056 100 µg

EWSR1 Mouse Monoclonal Antibody [Clone ID: OTI3F6]

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF640R conjugate, 0.1mg/mL
BNC401175-100 1x 100 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human FMN2 activation kit by CRISPRa
GA111227 1 Kit

Human FMN2 activation kit by CRISPRa

Sign In for Pricing
View Details