Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293)

MMP-9 is an important member of the MMP protein family and regulates the extracellular matrix during physiological processes such as development and tissue remodeling. It involves arthritis and metastasis. MMP-9 Protein, Human (HEK293) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293.html

Purity

95.00

Smiles

APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) NP_004985.2 (A20-D707) (Accession)

Molecular Weight

76-95 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SILAC-SFM Insect Medium
0429 500 mL

SILAC-SFM Insect Medium

Sign In for Pricing
View Details
Susd2 Mouse Gene Knockout Kit (CRISPR)
KN517001 1 Kit

Susd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APOL3 Polyclonal Antibody
E-AB-90695-01 60 µL

APOL3 Polyclonal Antibody

Sign In for Pricing
View Details
APOL3 Polyclonal Antibody
E-AB-90695-02 120 µL

APOL3 Polyclonal Antibody

Sign In for Pricing
View Details
APOL3 Polyclonal Antibody
E-AB-90695-03 200 µL

APOL3 Polyclonal Antibody

Sign In for Pricing
View Details
IFluor® 350 succinimidyl ester
71020-AAT 100 µg

IFluor® 350 succinimidyl ester

Sign In for Pricing
View Details