Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293)

MMP-9 is an important member of the MMP protein family and regulates the extracellular matrix during physiological processes such as development and tissue remodeling. It involves arthritis and metastasis. MMP-9 Protein, Human (HEK293) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293.html

Purity

95.00

Smiles

APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) NP_004985.2 (A20-D707) (Accession)

Molecular Weight

76-95 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (C81/2885R), Biotin conjugate, 0.1mg/mL
BNCB2885-500 1x 500 µL

CD81 / TAPA-1 (C81/2885R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sorcs1 Mouse Gene Knockout Kit (CRISPR)
KN316472 1 Kit

Sorcs1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR9Q2 (NM_001005283) Human Over-expression Lysate
LY423842 100 µg

OR9Q2 (NM_001005283) Human Over-expression Lysate

Sign In for Pricing
View Details
DOK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B11]
TA813139BM 100 µL

DOK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B11]

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (rSPTBN2/1778), CF647 conjugate, 0.1mg/mL
BNC473647-100 1x 100 µL

Spectrin beta III (SPTBN2) (rSPTBN2/1778), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-500 1x 500 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details