Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-9, Human (HEK293)

MMP-9 is an important member of the MMP protein family and regulates the extracellular matrix during physiological processes such as development and tissue remodeling. It involves arthritis and metastasis. MMP-9 Protein, Human (HEK293) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

MMP-9 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek293.html

Purity

95.00

Smiles

APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Formula

4318 (Gene_ID) NP_004985.2 (A20-D707) (Accession)

Molecular Weight

76-95 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GYPB Rabbit pAb, BF700 conjugated
orb2823937 100 µL

GYPB Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
OR4C12 Human siRNA Oligo Duplex (Locus ID 283093)
SR316980 1 Kit

OR4C12 Human siRNA Oligo Duplex (Locus ID 283093)

Sign In for Pricing
View Details
Horse Splicing Factor U2AF 65 kDa Subunit (U2AF2) ELISA Kit
MBS9927747-01 48 Well

Horse Splicing Factor U2AF 65 kDa Subunit (U2AF2) ELISA Kit

Sign In for Pricing
View Details
Horse Splicing Factor U2AF 65 kDa Subunit (U2AF2) ELISA Kit
MBS9927747-02 96 Well

Horse Splicing Factor U2AF 65 kDa Subunit (U2AF2) ELISA Kit

Sign In for Pricing
View Details
Horse Splicing Factor U2AF 65 kDa Subunit (U2AF2) ELISA Kit
MBS9927747-03 5x 96 Well

Horse Splicing Factor U2AF 65 kDa Subunit (U2AF2) ELISA Kit

Sign In for Pricing
View Details
Horse Splicing Factor U2AF 65 kDa Subunit (U2AF2) ELISA Kit
MBS9927747-04 10x 96 Well

Horse Splicing Factor U2AF 65 kDa Subunit (U2AF2) ELISA Kit

Sign In for Pricing
View Details