Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMBT1, Human (HEK293, His)

The DMBT1 protein is a potential tumor suppressor in a variety of cancers and affects a variety of biological processes. It contributes to mucosal and cellular immune defense, epithelial differentiation, and serves as an opsonin receptor for SFTPD and SPAR in macrophages. DMBT1 Protein, Human (HEK293, His) is the recombinant human-derived DMBT1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DMBT1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dmbt1-protein-human-hek293-his.html

Purity

96.90

Smiles

TGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTVAEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRIS

Molecular Formula

1755 (Gene_ID) Q9UGM3/NP_004397.2 (T20-S220) (Accession)

Molecular Weight

35-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-500 1x 500 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-500 1x 500 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-500 1x 500 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (MLANA/788), CF594 conjugate, 0.1mg/mL
BNC940788-500 1x 500 µL

MART-1 / Melan-A (MLANA/788), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (rKRT8.18/1346), CF647 conjugate, 0.1mg/mL
BNC472298-500 1x 500 µL

Cytokeratin 8/18 (rKRT8.18/1346), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (31A3), CF740 conjugate, 0.1mg/mL
BNC740046-100 1x 100 µL

Pgp9.5 (UCHL-1) (31A3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details