Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMBT1, Human (HEK293, His)

The DMBT1 protein is a potential tumor suppressor in a variety of cancers and affects a variety of biological processes. It contributes to mucosal and cellular immune defense, epithelial differentiation, and serves as an opsonin receptor for SFTPD and SPAR in macrophages. DMBT1 Protein, Human (HEK293, His) is the recombinant human-derived DMBT1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DMBT1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dmbt1-protein-human-hek293-his.html

Purity

96.90

Smiles

TGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTVAEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRIS

Molecular Formula

1755 (Gene_ID) Q9UGM3/NP_004397.2 (T20-S220) (Accession)

Molecular Weight

35-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (1,1,2,2-Tetrafluoroethoxy) aniline
sc-259118 5 g

2- (1,1,2,2-Tetrafluoroethoxy) aniline

Sign In for Pricing
View Details
MBNL1-AS1 Human shRNA Plasmid Kit (Locus ID 401093)
TL319266 1 Kit

MBNL1-AS1 Human shRNA Plasmid Kit (Locus ID 401093)

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Human IgG Fc Secondary Antibody (Pre-adsorbed)
NBP1-74981-0.5mg 0.5 mg

Goat Polyclonal Goat anti-Human IgG Fc Secondary Antibody (Pre-adsorbed)

Sign In for Pricing
View Details
OR11J7P 3'UTR Lenti-reporter-Luc Vector
34941081 1.0 µg

OR11J7P 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse monoclonal antibody to HCV NS5B RdRp, clone 10D6
A2-425-100-01 100 µg

Mouse monoclonal antibody to HCV NS5B RdRp, clone 10D6

Sign In for Pricing
View Details
Mouse monoclonal antibody to HCV NS5B RdRp, clone 10D6
A2-425-100-02 500 µg

Mouse monoclonal antibody to HCV NS5B RdRp, clone 10D6

Sign In for Pricing
View Details