Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-27 beta EBI3, Mouse (His)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling. Animal-Free IL-27 beta EBI3 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-27 EBI3 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-27 beta EBI3 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-27-ebi3-protein-mouse-his.html

Purity

95.0

Smiles

MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP

Molecular Formula

50498 (Gene_ID) O35228 (A23-P228) (Accession)

Molecular Weight

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish ASCL1A Rabbit Polyclonal Antibody (Fluoro550)
orb3089467 100 µg

Zebrafish ASCL1A Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
2-Acetyl-5-bromothiophene
414845-01 500 mg

2-Acetyl-5-bromothiophene

Sign In for Pricing
View Details
2-Acetyl-5-bromothiophene
414845-02 1 g

2-Acetyl-5-bromothiophene

Sign In for Pricing
View Details
C21orf109 CRISPR Knock Out 293T Cell Line (Human)
53733141 1x 10^6 Cells / 1.0 mL

C21orf109 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Bax Rabbit mAb
E2R22708 100 µL

Bax Rabbit mAb

Sign In for Pricing
View Details
SRSF3 Antibody
orb2674909-01 50 µL

SRSF3 Antibody

Sign In for Pricing
View Details