Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AADAC, Human (His-SUMO)

Product Specifications

UNSPSC Description

AADAC, Human (His-SUMO) is an esterase functioning at the endoplasmic reticulum which involved in the hydrolysis of various drugs. AADAC, Human overexpression alters multiple vascular smooth muscle cells properties and decreases murine cardiovascular disease.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aadac-protein-human-his-sumo.html

Purity

90.0

Smiles

PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL

Molecular Weight

Approximately 63.1 kDa

References & Citations

[1]Yoshida T, et, al. Difference in substrate specificity of carboxylesterase and arylacetamide deacetylase between dogs and humans. Eur J Pharm Sci. 2018 Jan 1;111:167-176.|[2]Misra A, et, al. Translational Research in Culture: AADAC, Diabetes, and Cardiovascular Disease. Cell Stem Cell. 2020 Jul 2;27(1):6-7.

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ADAMTS13 Antibody, Rabbit Polyclonal
MBS8126494-01 0.1 mL

Anti-ADAMTS13 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-ADAMTS13 Antibody, Rabbit Polyclonal
MBS8126494-02 5x 0.1 mL

Anti-ADAMTS13 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
LNPEP antibody
70R-18293 50 ul

LNPEP antibody

Sign In for Pricing
View Details
Inhibitor mmu-miR-871-5p AAV miRNA Vector
Amm3101300 500 ng

Inhibitor mmu-miR-871-5p AAV miRNA Vector

Sign In for Pricing
View Details
TBX3 Antibody
MBS8582413-01 0.1 mL

TBX3 Antibody

Sign In for Pricing
View Details
TBX3 Antibody
MBS8582413-02 0.1 mL (AF635)

TBX3 Antibody

Sign In for Pricing
View Details