AADAC, Human (His-SUMO)
Product Specifications
UNSPSC Description
AADAC, Human (His-SUMO) is an esterase functioning at the endoplasmic reticulum which involved in the hydrolysis of various drugs. AADAC, Human overexpression alters multiple vascular smooth muscle cells properties and decreases murine cardiovascular disease.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/aadac-protein-human-his-sumo.html
Purity
90.0
Smiles
PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL
Molecular Weight
Approximately 63.1 kDa
References & Citations
[1]Yoshida T, et, al. Difference in substrate specificity of carboxylesterase and arylacetamide deacetylase between dogs and humans. Eur J Pharm Sci. 2018 Jan 1;111:167-176.|[2]Misra A, et, al. Translational Research in Culture: AADAC, Diabetes, and Cardiovascular Disease. Cell Stem Cell. 2020 Jul 2;27(1):6-7.
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog