Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGF, Rat (Tag Free, Solution)

EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

Product Specifications

Product Name Alternative

EGF Protein, Rat (Tag Free, Solution), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-rat-tag-free.html

Purity

95.0

Smiles

MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

Molecular Formula

25313 (Gene_ID) P07522 (N974-R1026) (Accession)

Molecular Weight

Approximately 6-9 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N4-Acetylcytosine
TRC-N633020-5G 5 g

N4-Acetylcytosine

Sign In for Pricing
View Details
IRAG1 Rabbit Polyclonal Antibody
TA362843 100 µL

IRAG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Climatic Chamber BCCL-1415
BCCL-1415 1 Unit

Climatic Chamber BCCL-1415

Sign In for Pricing
View Details
Olokizumab Biosimilar - Research Grade
ICH5170-10mg 10 mg (2x 5 mg)

Olokizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
NR5A2 Human Gene Knockout Kit (CRISPR)
KN213887 1 Kit

NR5A2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human P3R3URF activation kit by CRISPRa
GA119974 1 Kit

Human P3R3URF activation kit by CRISPRa

Sign In for Pricing
View Details