Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGF, Rat (Tag Free, Solution)

EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

Product Specifications

Product Name Alternative

EGF Protein, Rat (Tag Free, Solution), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-rat-tag-free.html

Purity

95.0

Smiles

MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

Molecular Formula

25313 (Gene_ID) P07522 (N974-R1026) (Accession)

Molecular Weight

Approximately 6-9 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARRB1 Antibody
KC-6111-01 50 μL

ARRB1 Antibody

Sign In for Pricing
View Details
ARRB1 Antibody
KC-6111-02 100 µL

ARRB1 Antibody

Sign In for Pricing
View Details
ARRB1 Antibody
KC-6111-03 1 mL

ARRB1 Antibody

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), 0.2mg/mL
BNUB1231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), 0.2mg/mL

Sign In for Pricing
View Details
Rnf146 Mouse Monoclonal Antibody [Clone ID: N201/35]
75-233 100 µL

Rnf146 Mouse Monoclonal Antibody [Clone ID: N201/35]

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2688), CF647 conjugate, 0.1mg/mL
BNC472688-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2688), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details