Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGF, Rat (Tag Free, Solution)

EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

Product Specifications

Product Name Alternative

EGF Protein, Rat (Tag Free, Solution), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-rat-tag-free.html

Purity

95.0

Smiles

MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

Molecular Formula

25313 (Gene_ID) P07522 (N974-R1026) (Accession)

Molecular Weight

Approximately 6-9 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuropeptide FF2 Receptor (NPFFR2, NPFF2, NPFF-2, NPFF 2) (APC)
301418-APC 100 µL

Neuropeptide FF2 Receptor (NPFFR2, NPFF2, NPFF-2, NPFF 2) (APC)

Sign In for Pricing
View Details
SEC24D Polyclonal Antibody
MBS8570768-01 0.1 mL

SEC24D Polyclonal Antibody

Sign In for Pricing
View Details
SEC24D Polyclonal Antibody
MBS8570768-02 0.1 mL (AF405L)

SEC24D Polyclonal Antibody

Sign In for Pricing
View Details
SEC24D Polyclonal Antibody
MBS8570768-03 0.1 mL (AF405S)

SEC24D Polyclonal Antibody

Sign In for Pricing
View Details
SEC24D Polyclonal Antibody
MBS8570768-04 0.1 mL (AF610)

SEC24D Polyclonal Antibody

Sign In for Pricing
View Details
SEC24D Polyclonal Antibody
MBS8570768-05 0.1 mL (AF635)

SEC24D Polyclonal Antibody

Sign In for Pricing
View Details