Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Human

IL-1RA/IL-1RN Protein, Human is a member of the IL-1 family that binds to IL-1 receptors.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-human.html

Purity

98.0

Smiles

RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Molecular Formula

3557 (Gene_ID) P18510-1 (R26-E177) (Accession)

Molecular Weight

Approximately 15-19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Arend WP, et al. Interleukin-1 receptor antagonist: role in biology. Annu Rev Immunol. 1998;16:27-55.|[2]Nikolic-Paterson DJ, et al. Interleukin-1 receptor antagonism. Semin Nephrol. 1996 Nov;16 (6) :583-90.|[3]Arend WP, et al. Interleukin 1 receptor antagonist. A new member of the interleukin 1 family. J Clin Invest. 1991 Nov;88 (5) :1445-51.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RBMY1A1 (RNA-binding Motif Protein, Y Chromosome, Family 1 Member A1/C, RNA-binding Motif Protein 1, RNA-binding Motif Protein 2, Y Chromosome RNA Recognition Motif 1, hRBMY, RBM1, RBM2, YRRM1, RBMY1C) (PE)
R2033-01-PE 100 µL

RBMY1A1 (RNA-binding Motif Protein, Y Chromosome, Family 1 Member A1/C, RNA-binding Motif Protein 1, RNA-binding Motif Protein 2, Y Chromosome RNA Recognition Motif 1, hRBMY, RBM1, RBM2, YRRM1, RBMY1C) (PE)

Ask
View Details
CDK20 Overexpression Lysate (Native) - (Dry Ice)
NBP2-04973 0.1 mg

CDK20 Overexpression Lysate (Native) - (Dry Ice)

Ask
View Details
HIST1H4A (Ab-20) Antibody
A25168-50UL 50 μL

HIST1H4A (Ab-20) Antibody

Ask
View Details
Novokinin (TFA)
HY-P0080A 1 Each

Novokinin (TFA)

Ask
View Details
CRYGA (NM_014617) Human Tagged ORF Clone
RC224787 10 µg

CRYGA (NM_014617) Human Tagged ORF Clone

Ask
View Details