Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RA/IL-1RN, Human

IL-1RA/IL-1RN Protein, Human is a member of the IL-1 family that binds to IL-1 receptors.

Product Specifications

Product Name Alternative

IL-1RA/IL-1RN Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1ra-il-1rn-protein-human.html

Purity

98.0

Smiles

RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Molecular Formula

3557 (Gene_ID) P18510-1 (R26-E177) (Accession)

Molecular Weight

Approximately 15-19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Arend WP, et al. Interleukin-1 receptor antagonist: role in biology. Annu Rev Immunol. 1998;16:27-55.|[2]Nikolic-Paterson DJ, et al. Interleukin-1 receptor antagonism. Semin Nephrol. 1996 Nov;16 (6) :583-90.|[3]Arend WP, et al. Interleukin 1 receptor antagonist. A new member of the interleukin 1 family. J Clin Invest. 1991 Nov;88 (5) :1445-51.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPARGC1A (Peroxisome Proliferator-Activated Receptor gamma, Coactivator 1 alpha, LEM6, PGC-1 (alpha), PGC-1v, PGC1, PGC1A, PPARGC1) (MaxLight 490)
250343-ML490 100 µL

PPARGC1A (Peroxisome Proliferator-Activated Receptor gamma, Coactivator 1 alpha, LEM6, PGC-1 (alpha), PGC-1v, PGC1, PGC1A, PPARGC1) (MaxLight 490)

Sign In for Pricing
View Details
TRAP (AB1355) Rabbit mAb
M3014-01 20 µL

TRAP (AB1355) Rabbit mAb

Sign In for Pricing
View Details
TRAP (AB1355) Rabbit mAb
M3014-02 50 μL

TRAP (AB1355) Rabbit mAb

Sign In for Pricing
View Details
TRAP (AB1355) Rabbit mAb
M3014-03 100 µL

TRAP (AB1355) Rabbit mAb

Sign In for Pricing
View Details
TRAP (AB1355) Rabbit mAb
M3014-04 200 µL

TRAP (AB1355) Rabbit mAb

Sign In for Pricing
View Details
TFIIB (GTF2B) (NM_001514) Human Over-expression Lysate
LC400582 20 µg

TFIIB (GTF2B) (NM_001514) Human Over-expression Lysate

Sign In for Pricing
View Details