Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Human

IFN-gamma Protein, human activates STAT signaling pathway and affects gene regulation. IFN-gamma Protein, human activates effector immune cells and enhances antigen presentation. IFN-gamma Protein, human also regulates the hematopoietic stem cells development. IFN-gamma Protein, human is the recombinant human-derived IFN-gamma Protein, expressed by E. coli.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-human.html

Purity

98.0

Smiles

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Molecular Formula

3458 (Gene_ID) P01579 (Q24-Q166) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Razaghi A, et al. Review of the recombinant human interferon gamma as an immunotherapeutic: Impacts of production platforms and glycosylation. J Biotechnol. 2016 Dec 20;240:48-60.|[2]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.|[3]Jiang Z, et al., IFI16 directly senses viral RNA and enhances RIG-I transcription and activation to restrict influenza virus infection. Nat Microbiol. 2021 Jul;6 (7) :932-945.|[4]Gao L, et al., MiR-873/PD-L1 axis regulates the stemness of breast cancer cells. EBioMedicine. 2019 Mar;41:395-407.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse IgG2a, kappa Isotype Control (PerCP Conjugated)
MBS2557761-01 20 Tests

Mouse IgG2a, kappa Isotype Control (PerCP Conjugated)

Ask
View Details
Mouse IgG2a, kappa Isotype Control (PerCP Conjugated)
MBS2557761-02 50 Tests

Mouse IgG2a, kappa Isotype Control (PerCP Conjugated)

Ask
View Details
Mouse IgG2a, kappa Isotype Control (PerCP Conjugated)
MBS2557761-03 100 Tests

Mouse IgG2a, kappa Isotype Control (PerCP Conjugated)

Ask
View Details
Mouse IgG2a, kappa Isotype Control (PerCP Conjugated)
MBS2557761-04 200 Tests

Mouse IgG2a, kappa Isotype Control (PerCP Conjugated)

Ask
View Details
Mouse IgG2a, kappa Isotype Control (PerCP Conjugated)
MBS2557761-05 5x 200 Tests

Mouse IgG2a, kappa Isotype Control (PerCP Conjugated)

Ask
View Details
Human THOC6 qPCR Primer Pair
QH51393S 200 Tests

Human THOC6 qPCR Primer Pair

Ask
View Details