Nucleobindin-2, Human
Nucleobindin-2 protein is a calcium-binding molecule that may contribute to calcium homeostasis and act as a non-receptor guanine nucleotide exchange factor. Its interaction with the guanine nucleotide-binding protein (G protein) α subunit GNAI3 suggests its role in activating the G protein signaling pathway. Nucleobindin-2 Protein, Human is the recombinant human-derived Nucleobindin-2 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
Nucleobindin-2 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nucleobindin-2-protein-human.html
Purity
95.0
Smiles
VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL
Molecular Formula
4925 (Gene_ID) P80303-1 (V25-L106) (Accession)
Molecular Weight
Approximately 10.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
CD11b (CD11 antigen-like family member B, CD11b/CD18, CD49d, Cell surface glycoprotein MAC-1 subunit alpha, Complement Component Receptor 3 Alpha, CR3 Alpha Chain (CR3A), Integrin alpha-M, Integrin beta 2 alpha subunit, ITGAM, Leukocyte adhesion receptor MO1, Ly-40, Mac-1a, MAC1, Mac1, alpha subunit, MAC1A, Macrophage antigen alpha polypeptide, MO1A, Neutrophil adherence receptor alpha M subunit) (BSA & Azide Free) (MaxLight 490)
