Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleobindin-2, Human

Nucleobindin-2 protein is a calcium-binding molecule that may contribute to calcium homeostasis and act as a non-receptor guanine nucleotide exchange factor. Its interaction with the guanine nucleotide-binding protein (G protein) α subunit GNAI3 suggests its role in activating the G protein signaling pathway. Nucleobindin-2 Protein, Human is the recombinant human-derived Nucleobindin-2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Nucleobindin-2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleobindin-2-protein-human.html

Purity

95.0

Smiles

VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL

Molecular Formula

4925 (Gene_ID) P80303-1 (V25-L106) (Accession)

Molecular Weight

Approximately 10.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-100 1x 100 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-100 1x 100 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-100 1x 100 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-100 1x 100 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
BNC740806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details