Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin, Rat (His)

Prolactin Protein primarily promotes lactation by exerting its main actions on the mammary gland.This crucial function is facilitated through interaction with its specific receptor, PRLR.Prolactin Protein, Rat (His) is the recombinant rat-derived Prolactin protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Prolactin Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-protein-rat-his.html

Purity

98.0

Smiles

LPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFIAKAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITGLGGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQLPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC

Molecular Formula

24683 (Gene_ID) P01237 (L30-C226) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rag2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6733708 1.0 µg DNA

Rag2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
ANKS1B Human Over-expression Lysate
orb1354672 100 µg

ANKS1B Human Over-expression Lysate

Sign In for Pricing
View Details
Nesprin 2 (SYNE2) Human qPCR Primer Pair (NM_182914)
HP232065 200 Reactions

Nesprin 2 (SYNE2) Human qPCR Primer Pair (NM_182914)

Sign In for Pricing
View Details
PPIE, NT (PPIE, CYP33, Peptidyl-prolyl cis-trans isomerase E, Cyclophilin E, Cyclophilin-33, Rotamase E) (Biotin) discontinued
040314-Biotin 200 µL

PPIE, NT (PPIE, CYP33, Peptidyl-prolyl cis-trans isomerase E, Cyclophilin E, Cyclophilin-33, Rotamase E) (Biotin) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal RNFT2 Antibody [Alexa Fluor 488]
NBP3-06145AF488 0.1 mL

Rabbit Polyclonal RNFT2 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
MS4A7 (4SPAN2, CD20L4, CFFM4, Membrane-spanning 4-domains Subfamily A Member 7, CD20 Antigen-like 4, CD20/FC-epsilon-RI-beta Family Member 4, Four-span Transmembrane Protein 2, MGC22368, MS4A8) (PE)
MBS6158907-01 0.1 mL

MS4A7 (4SPAN2, CD20L4, CFFM4, Membrane-spanning 4-domains Subfamily A Member 7, CD20 Antigen-like 4, CD20/FC-epsilon-RI-beta Family Member 4, Four-span Transmembrane Protein 2, MGC22368, MS4A8) (PE)

Sign In for Pricing
View Details