Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Rat (HEK293, His)

ROR1 protein is an important member of the Tyr protein kinase family in the protein kinase superfamily and plays a key role as a tyrosine kinase in cell signaling and regulation. Its classification emphasizes its importance in phosphorylation events and shares conserved features with related kinases. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-rat-hek293-his.html

Purity

95.00

Smiles

QETELSVSAELVPTSSWNTSSEIDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

362550 (Gene_ID) D3ZZ97/EDL97819.1 (Q30-E403) (Accession)

Molecular Weight

60-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf156 Protein Vector (Human) (pPB-C-His)
PV006989 500 ng

C9orf156 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
GSTCD (NM_001031720) Human Tagged Lenti ORF Clone
RC205989L3 10 µg

GSTCD (NM_001031720) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Tert shRNA (UAS) - Lentiviral mouse Tert shRNA (UAS, GFP) (100)
GTR15125733 1 Vial

Lentiviral mouse Tert shRNA (UAS) - Lentiviral mouse Tert shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Mouse a2M (Alpha-2-Macroglobulin) ELISA Kit
MBS8821590-01 48 Well

Mouse a2M (Alpha-2-Macroglobulin) ELISA Kit

Sign In for Pricing
View Details
Mouse a2M (Alpha-2-Macroglobulin) ELISA Kit
MBS8821590-02 96 Well

Mouse a2M (Alpha-2-Macroglobulin) ELISA Kit

Sign In for Pricing
View Details
Mouse a2M (Alpha-2-Macroglobulin) ELISA Kit
MBS8821590-03 5x 96 Well

Mouse a2M (Alpha-2-Macroglobulin) ELISA Kit

Sign In for Pricing
View Details