Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Rat (HEK293, His)

ROR1 protein is an important member of the Tyr protein kinase family in the protein kinase superfamily and plays a key role as a tyrosine kinase in cell signaling and regulation. Its classification emphasizes its importance in phosphorylation events and shares conserved features with related kinases. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-rat-hek293-his.html

Purity

95.00

Smiles

QETELSVSAELVPTSSWNTSSEIDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

362550 (Gene_ID) D3ZZ97/EDL97819.1 (Q30-E403) (Accession)

Molecular Weight

60-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rdh11 (NM_021557) Mouse Tagged Lenti ORF Clone
MR204536L3 10 µg

Rdh11 (NM_021557) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MonoMethyl-Histone H2B (Lys116) Recombinant Rabbit mAb
E43S43415 100 µL

MonoMethyl-Histone H2B (Lys116) Recombinant Rabbit mAb

Sign In for Pricing
View Details
GKI-1 HCl
MBS5801606 Inquire

GKI-1 HCl

Sign In for Pricing
View Details
2- (Di-tert-butylphosphino) -2',4',6'- triisopropyl-3,6-dimethoxy-1,1'-biphenyl
273740-01 50 mg

2- (Di-tert-butylphosphino) -2',4',6'- triisopropyl-3,6-dimethoxy-1,1'-biphenyl

Sign In for Pricing
View Details
2- (Di-tert-butylphosphino) -2',4',6'- triisopropyl-3,6-dimethoxy-1,1'-biphenyl
273740-02 100 mg

2- (Di-tert-butylphosphino) -2',4',6'- triisopropyl-3,6-dimethoxy-1,1'-biphenyl

Sign In for Pricing
View Details
2- (Di-tert-butylphosphino) -2',4',6'- triisopropyl-3,6-dimethoxy-1,1'-biphenyl
273740-03 250 mg

2- (Di-tert-butylphosphino) -2',4',6'- triisopropyl-3,6-dimethoxy-1,1'-biphenyl

Sign In for Pricing
View Details