Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Rat (HEK293, His)

ROR1 protein is an important member of the Tyr protein kinase family in the protein kinase superfamily and plays a key role as a tyrosine kinase in cell signaling and regulation. Its classification emphasizes its importance in phosphorylation events and shares conserved features with related kinases. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-rat-hek293-his.html

Purity

95.00

Smiles

QETELSVSAELVPTSSWNTSSEIDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

362550 (Gene_ID) D3ZZ97/EDL97819.1 (Q30-E403) (Accession)

Molecular Weight

60-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VMN1R6 Adenovirus (Mouse)
49687054 1.0 mL

VMN1R6 Adenovirus (Mouse)

Sign In for Pricing
View Details
VPREB3 (NM_013378) Human Over-expression Lysate
LS029802-100ug 100 µg

VPREB3 (NM_013378) Human Over-expression Lysate

Sign In for Pricing
View Details
SPATA17 Protein Vector (Mouse) (pPB-C-His)
PV233050 500 ng

SPATA17 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
TRNAR15 Protein Vector (Human) (pPM-C-HA)
48336021 500 ng

TRNAR15 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CD300f Polyclonal Antibody
MBS9243002-01 0.1 mL

CD300f Polyclonal Antibody

Sign In for Pricing
View Details
CD300f Polyclonal Antibody
MBS9243002-02 5x 0.1 mL

CD300f Polyclonal Antibody

Sign In for Pricing
View Details