Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1, Rat (HEK293, His)

ROR1 protein is an important member of the Tyr protein kinase family in the protein kinase superfamily and plays a key role as a tyrosine kinase in cell signaling and regulation. Its classification emphasizes its importance in phosphorylation events and shares conserved features with related kinases. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

ROR1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ror1-protein-rat-hek293-his.html

Purity

95.00

Smiles

QETELSVSAELVPTSSWNTSSEIDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Formula

362550 (Gene_ID) D3ZZ97/EDL97819.1 (Q30-E403) (Accession)

Molecular Weight

60-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Rat CD30 (Cluster of differentiation 30)
E-EL-R0216 96 Tests

ELISA kit for Rat CD30 (Cluster of differentiation 30)

Sign In for Pricing
View Details
FOXI2, ID (FOXI2, Forkhead box protein I2) (MaxLight 650)
MBS6299814-01 0.1 mL

FOXI2, ID (FOXI2, Forkhead box protein I2) (MaxLight 650)

Sign In for Pricing
View Details
FOXI2, ID (FOXI2, Forkhead box protein I2) (MaxLight 650)
MBS6299814-02 5x 0.1 mL

FOXI2, ID (FOXI2, Forkhead box protein I2) (MaxLight 650)

Sign In for Pricing
View Details
KCTD21 (NM_001029859) Human Tagged ORF Clone
RG206177 10 µg

KCTD21 (NM_001029859) Human Tagged ORF Clone

Sign In for Pricing
View Details
BMPR1A protein, Human, Recombinant (His)
E51P90774 20 µg

BMPR1A protein, Human, Recombinant (His)

Sign In for Pricing
View Details
CT62 (NM_001102658) Human Over-expression Lysate
LY420183 100 µg

CT62 (NM_001102658) Human Over-expression Lysate

Sign In for Pricing
View Details